Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate H281DRAFT_00093 H281DRAFT_00093 amino acid/amide ABC transporter membrane protein 1, HAAT family
Query= uniprot:Q1MCU0 (300 letters) >FitnessBrowser__Burk376:H281DRAFT_00093 Length = 551 Score = 125 bits (313), Expect = 3e-33 Identities = 85/287 (29%), Positives = 141/287 (49%), Gaps = 6/287 (2%) Query: 8 LLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFAGLPVA 67 L GL+LGS+ L A+G + YG+IG+IN AHG+ M+G +A +V L FA Sbjct: 258 LFAGLSLGSVLLLAALGLAITYGLIGVINMAHGEFLMIGAYATYVV-QNLFQRFAPGGFD 316 Query: 68 VLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQVTQGPRN 127 LV + + + +L IER+ + L G L L+T G+S+ L ++ G +N Sbjct: 317 WYPLVAVPASFVAAALVGIVIERLVLKHLYGR-PLETLLTTFGISLILIQATRMLFGAQN 375 Query: 128 KPIPP---MVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRATEQDRK 184 + M V N+ + ++ I+ + +++ I W ++ +T LG RA Q+R+ Sbjct: 376 VQVVNPSWMSGGVTVMANLILPYNRLAILAFSLIVVGIAWAVLTKTRLGLFVRAVTQNRR 435 Query: 185 MAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAAVLGGIG 244 MAA +GV + S F GA +A + G L G + G + + +F A VLGG+G Sbjct: 436 MAACVGVKTARVDSYAFAFGAGIAGLGGCA-LSQIGNVGPDLGQSYIIDSFMAVVLGGVG 494 Query: 245 SLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGI 291 L G V GG +GL+ ++ +A ++ + +P G+ Sbjct: 495 QLAGTVIGGFGLGLVSKAIEPFWGAVLAKIAVLVLIVLFIQKRPQGM 541 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 551 Length adjustment: 31 Effective length of query: 269 Effective length of database: 520 Effective search space: 139880 Effective search space used: 139880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory