Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate H281DRAFT_04061 H281DRAFT_04061 amino acid/amide ABC transporter membrane protein 2, HAAT family
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__Burk376:H281DRAFT_04061 Length = 389 Score = 245 bits (625), Expect = 2e-69 Identities = 149/326 (45%), Positives = 195/326 (59%), Gaps = 33/326 (10%) Query: 137 NFGIQIL----IYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGLS----- 187 N+ +++L +YVMLA GLN+VVG AGLLDLGY+AFYAVGAY+ ALLSS S Sbjct: 46 NYWVRVLDFAMLYVMLALGLNVVVGFAGLLDLGYIAFYAVGAYTAALLSSPHLTSQFEWI 105 Query: 188 -----------FWVLLPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINW 236 F +++P + AA +GVILG P LRLRGDYLAIVTL FGEI+R+ L N Sbjct: 106 AHLAPNGLHVPFLIIVPCAMAVAAFFGVILGAPTLRLRGDYLAIVTLGFGEIVRIFLNNL 165 Query: 237 ---TDVTKGTFGISSIPKATLFGIPFDATAGGFAKLFHLPISSAYYKIFLFYLILALCML 293 ++T G GI+ I L T F F P +YY YL + +L Sbjct: 166 DRPVNITNGPKGITGIDSVHLGDFSLAQTHSLFG--FQFPSVYSYY-----YLFVLAALL 218 Query: 294 TAYVTIRLRRMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQ 353 +V RL+ IGRAW A+REDEIA +++GINT KL AFA GA F G +G+ F A Q Sbjct: 219 VIWVCTRLQHSRIGRAWAAIREDEIAAKAMGINTRNVKLLAFAMGASFGGLSGAMFGAFQ 278 Query: 354 GFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMVGGTELLREM--SFLKLIFGPD 411 GFVSPESF ES V+LA VVLGGMG + G+ + A+++ E LR ++FG + Sbjct: 279 GFVSPESFTLPESIVVLACVVLGGMGHIPGVILGAVLLAVLPEFLRSTMGPLQHMLFGHE 338 Query: 412 FT-PELYRMLIFGLAMVVVMLFKPRG 436 E+ R L++ LAMV++ML++ G Sbjct: 339 IVDTEVIRQLVYALAMVLIMLYRSEG 364 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 389 Length adjustment: 32 Effective length of query: 431 Effective length of database: 357 Effective search space: 153867 Effective search space used: 153867 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory