Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate H281DRAFT_01586 H281DRAFT_01586 amino acid/amide ABC transporter ATP-binding protein 1, HAAT family
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__Burk376:H281DRAFT_01586 Length = 269 Score = 152 bits (384), Expect = 8e-42 Identities = 96/259 (37%), Positives = 138/259 (53%), Gaps = 16/259 (6%) Query: 13 TLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMIT 72 +LL V L FGGL A++D SF + G + AL+GPNGAGK+T FN + G P+ G I Sbjct: 2 SLLHVSGLCKSFGGLKAVDDVSFTLEAGQLLALLGPNGAGKSTCFNMVNGQLSPSSGSIR 61 Query: 73 FNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTI 132 F+ G + + R D V RTFQ F+ +TVLEN+ +A ++ K G Sbjct: 62 FD---GHELVGMRPRDIW---RLGVGRTFQIAATFNSMTVLENVQMALVSRERKTFGV-- 113 Query: 133 LGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPEL 192 +K A+ + A LE+ + A+ G L YG +R+E+A A+ P+L Sbjct: 114 --------WKPAASRYADEAFALLEQVGMAADANRACGVLAYGDVKRVELAIALANRPKL 165 Query: 193 LCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKIS 252 L +DEP AG+ P+E L AL K + E +L EH M VV +D ++VL G+ I+ Sbjct: 166 LLMDEPTAGMAPKERNELMALTKRLVTEQKIGVLFTEHSMDVVFAYADRMIVLARGKLIA 225 Query: 253 DGTPDHVKNDPRVIAAYLG 271 +G D ++NDPRV Y G Sbjct: 226 EGDGDTIRNDPRVQEVYFG 244 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 269 Length adjustment: 26 Effective length of query: 266 Effective length of database: 243 Effective search space: 64638 Effective search space used: 64638 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory