Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate H281DRAFT_05513 H281DRAFT_05513 branched-chain amino acid transport system permease protein
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__Burk376:H281DRAFT_05513 Length = 597 Score = 149 bits (376), Expect = 2e-40 Identities = 97/270 (35%), Positives = 146/270 (54%), Gaps = 24/270 (8%) Query: 11 DDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGM 70 D L VE +S ++GG++A++D SF G I LIGPNGAGK+T+ N I G Y G Sbjct: 342 DGCSLTVESVSKQYGGVLAVSDVSFSVAAGQIHGLIGPNGAGKSTLVNLIAGNYLCDSGR 401 Query: 71 ITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGY 130 + + + + +ARTFQN++L L VLEN+L+ + A G+ Sbjct: 402 VRLDGADVSNLVTAD------RAKRGLARTFQNLQLVEALPVLENVLLG----MSSADGH 451 Query: 131 TI------LGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIAR 184 +G P +REA E LA F +E +L YG ++ +E+AR Sbjct: 452 VANFAKWWMGRAFDLPERREALEI--LAFFGIEHL-----CQAYPTELSYGHRKLVELAR 504 Query: 185 AMCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVV 244 A+ P L+ LDEP AGLN E+ + ++ +R + G +ILLIEH+M VM + D + V Sbjct: 505 AIAQRPRLMLLDEPIAGLNGAEAMEVAKVVGRLR-DAGVTILLIEHNMEFVMSLCDSISV 563 Query: 245 LEYGQKISDGTPDHVKNDPRVIAAYLGVED 274 LE G+ I GTP+ +++D R++ AYLG ++ Sbjct: 564 LEQGRLIGTGTPEEIRSDERILRAYLGTDE 593 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 597 Length adjustment: 31 Effective length of query: 261 Effective length of database: 566 Effective search space: 147726 Effective search space used: 147726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory