Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate H281DRAFT_04059 H281DRAFT_04059 amino acid/amide ABC transporter ATP-binding protein 2, HAAT family
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__Burk376:H281DRAFT_04059 Length = 240 Score = 242 bits (618), Expect = 4e-69 Identities = 126/240 (52%), Positives = 176/240 (73%), Gaps = 8/240 (3%) Query: 7 TGQPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTG 66 T Q +L++ G++ YG I+A+ G+D+ V +GE+V+LIGANGAGK+T M I G G Sbjct: 3 TTQAMLKIKGLQVNYGGIQAVKGIDLEVGQGELVTLIGANGAGKTTTMKAITGLKPYAAG 62 Query: 67 SVVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGL----DNLKHFAED 122 + + G+ I +P HE+ + +A PEGR IF RM+++EN+QMGA L D +K D Sbjct: 63 DIEYMGQSIKGVPPHELLKRGLAMVPEGRGIFARMSIVENMQMGAYLRSDNDGIK---AD 119 Query: 123 VEKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGI 182 V+++F FPRLKER Q GTLSGGEQQML++ RA+++RPKLLLLDEPS+GL+P++V+ I Sbjct: 120 VDRMFGFFPRLKERATQYAGTLSGGEQQMLAMARAIISRPKLLLLDEPSMGLSPIMVEKI 179 Query: 183 FEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 FE +R ++ AEG+TV LVEQNA AL+ ++R YVM +G VTMSG K++L +P+VRAAYL Sbjct: 180 FEVVRAIS-AEGMTVLLVEQNARLALQAANRGYVMDSGLVTMSGDAKQMLDDPKVRAAYL 238 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 240 Length adjustment: 23 Effective length of query: 224 Effective length of database: 217 Effective search space: 48608 Effective search space used: 48608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory