Align histidine ABC transporter, periplasmic histidine-binding protein HisJ (characterized)
to candidate H281DRAFT_02292 H281DRAFT_02292 amino acid ABC transporter substrate-binding protein, PAAT family
Query= CharProtDB::CH_014295 (260 letters) >FitnessBrowser__Burk376:H281DRAFT_02292 Length = 264 Score = 230 bits (586), Expect = 3e-65 Identities = 119/261 (45%), Positives = 164/261 (62%), Gaps = 4/261 (1%) Query: 1 MKKLVLSLSLVLAFSSATAAFAAIPQN---IRIGTDPTYAPFESKNSQGELVGFDIDLAK 57 MK L L+L AF+S A+ AA+ + +R G + Y PFESK GEL G DID+ Sbjct: 1 MKLLKPLLALACAFASVAASSAAVAADTSTLRFGLEAQYPPFESKGPNGELQGLDIDVGN 60 Query: 58 ELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLV 117 +C + C +VE D LIP+L+ +K DAI S+++ T++R+Q I FT +Y ++L+ Sbjct: 61 AVCVAAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATDQRRQTIDFTTVVYRVPTQLI 120 Query: 118 VAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRI 177 ++S + PT E+LKGKRVGVLQ + QETF HW P G+ +V YQ Q+ +Y+DL AGR+ Sbjct: 121 AKRDSGLLPTPEALKGKRVGVLQASIQETFAKAHWEPAGVTVVPYQDQNQVYTDLVAGRL 180 Query: 178 DAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFA 237 DA A GFL +P GKDY F G V+D+K+ G G G+RK D LRE LN A A Sbjct: 181 DATLVLAPAGQTGFLSKPNGKDYAFVGQPVRDDKILGSGIAYGIRKGDTALRERLNAAIA 240 Query: 238 EMRADGTYEKLAKKYF-DFDV 257 +++ADGT + LA KY D D+ Sbjct: 241 KVQADGTVKTLAAKYLGDIDI 261 Lambda K H 0.315 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 264 Length adjustment: 25 Effective length of query: 235 Effective length of database: 239 Effective search space: 56165 Effective search space used: 56165 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory