Align Formiminoglutamase (EC 3.5.3.8) (characterized)
to candidate H281DRAFT_03347 H281DRAFT_03347 formiminoglutamase
Query= reanno::Koxy:BWI76_RS08725 (318 letters) >FitnessBrowser__Burk376:H281DRAFT_03347 Length = 322 Score = 217 bits (553), Expect = 3e-61 Identities = 132/321 (41%), Positives = 178/321 (55%), Gaps = 16/321 (4%) Query: 6 PTPAALWQGRDDSAEAANALRLFQTIVRAERFEPEMLAGDI-ALLGFACDEGVRRNKGRT 64 P +W GR D E + R+F + + + D+ ++GF+ DEGVRRN+GR Sbjct: 4 PFDGKVWAGRSDDGEPGDTRRVFNQVTPFG--SAQQVQRDVPVIVGFSSDEGVRRNQGRI 61 Query: 65 GAERGPETLRRALANMASHDGHDRCVDMGTIHVADDALEAAQQALREAVTACQRAGKRTL 124 GA P+ LRR LA + + D G + D LEAAQ L V+ +G R L Sbjct: 62 GAAHAPKELRRVLAGLPAKAAIAALADAGDVVCDDGDLEAAQAELAHVVSEVLASGARPL 121 Query: 125 VLGGGHETAFGHGAGVLDAFPGEEVG------------IINLDAHLDLRIADRASSGTPF 172 V GGGHE A+G +G L E G IIN DAH DLR A+SGTPF Sbjct: 122 VFGGGHEVAWGTYSG-LRLHQQREAGNQATLLISRKLLIINFDAHFDLRQKRPANSGTPF 180 Query: 173 RQLALACEAQRRAFHYACIGVSRAANTQALLDEAARRGVTIIEDLDVLNAFEARAIPELA 232 Q+AL CE + +F+Y C G+S NT +L A R GV + D+D+ + + EL Sbjct: 181 DQIALDCEERGVSFNYVCFGISDLGNTASLFAHAERLGVRYVLDVDMQETQLPQRLNELQ 240 Query: 233 RNIARYDRLYLTIDLDVLPAREMPAVSAPAALGIPLATLLRIVEPLCRSGKLQAVDLVEF 292 + + D +YLTIDLDVLPA P VSAPAALG+PL+ + +V + SGKL+A D+ E+ Sbjct: 241 KLLDAADDVYLTIDLDVLPAATAPGVSAPAALGVPLSVVEAMVLRVRASGKLRASDIAEY 300 Query: 293 NPQYDIDSQGARAAARLAWQI 313 NP D D + ARAAARLA+++ Sbjct: 301 NPTLDQDRRTARAAARLAYRL 321 Lambda K H 0.322 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 322 Length adjustment: 28 Effective length of query: 290 Effective length of database: 294 Effective search space: 85260 Effective search space used: 85260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate H281DRAFT_03347 H281DRAFT_03347 (formiminoglutamase)
to HMM TIGR01227 (hutG: formimidoylglutamase (EC 3.5.3.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01227.hmm # target sequence database: /tmp/gapView.28419.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01227 [M=307] Accession: TIGR01227 Description: hutG: formimidoylglutamase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-94 301.8 0.1 3.1e-94 301.6 0.1 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_03347 H281DRAFT_03347 formiminoglutama Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_03347 H281DRAFT_03347 formiminoglutamase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 301.6 0.1 3.1e-94 3.1e-94 1 304 [. 10 320 .. 10 322 .] 0.93 Alignments for each domain: == domain 1 score: 301.6 bits; conditional E-value: 3.1e-94 TIGR01227 1 lqgrldleeaskkrrdeqvakvvdlveledaqdekgvaliGvaldkgvirnkGrtGAkeaPsairq 66 + gr d e ++ rr+++ +++ ++ + ++++G+ +d+gv+rn+Gr+GA +aP+ +r+ lcl|FitnessBrowser__Burk376:H281DRAFT_03347 10 WAGRSDDGEPGDTRRVFNQVTPFGSA---QQVQRDVPVIVGFSSDEGVRRNQGRIGAAHAPKELRR 72 78889999999999998888888773...44677889***************************** PP TIGR01227 67 alanlgdlvasealyDlGdivlegddlvdaqkevaqavaelladarvvvllGGdneiayatikala 132 la+l++ a al+D+Gd+v++++dl++aq+e+a++v e+la+++++++ GG++e+a+ t+ +l+ lcl|FitnessBrowser__Burk376:H281DRAFT_03347 73 VLAGLPAKAAIAALADAGDVVCDDGDLEAAQAELAHVVSEVLASGARPLVFGGGHEVAWGTYSGLR 138 *****************************************************************9 PP TIGR01227 133 qa...akgek..........riGvinfDAHfDlRavederptsGTpfrqlldeeqaed..fhlivl 183 + + +infDAHfDlR+ + sGTpf q++ +++ + f++++ lcl|FitnessBrowser__Burk376:H281DRAFT_03347 139 LHqqrE---AgnqatllisrKLLIINFDAHFDLRQKR--PANSGTPFDQIALDCEERGvsFNYVCF 199 985332...22446677776677***********998..999****************99****** PP TIGR01227 184 GirrfsntqalfdyakkkgvryvtddalaelsletikdileefldevDfiyltvdlDVldaasAPG 249 Gi+ ++nt++lf++a+++gvryv+d ++e++l++ ++ l+++ld D +ylt+dlDVl+aa APG lcl|FitnessBrowser__Burk376:H281DRAFT_03347 200 GISDLGNTASLFAHAERLGVRYVLDVDMQETQLPQRLNELQKLLDAADDVYLTIDLDVLPAATAPG 265 ****************************************************************** PP TIGR01227 250 vsApaagGleleellelvkriaasdkvrgveivEvnPtlDaddrTarlaArlvah 304 vsApaa G+ l++++++v r+ as+k+r +i+E+nPtlD d rTar+aArl lcl|FitnessBrowser__Burk376:H281DRAFT_03347 266 VSAPAALGVPLSVVEAMVLRVRASGKLRASDIAEYNPTLDQDRRTARAAARLAYR 320 ***************************************************9765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (322 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.58 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory