Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate H281DRAFT_04867 H281DRAFT_04867 N-formylglutamate deformylase
Query= reanno::BFirm:BPHYT_RS07585 (271 letters) >FitnessBrowser__Burk376:H281DRAFT_04867 Length = 270 Score = 483 bits (1243), Expect = e-141 Identities = 235/269 (87%), Positives = 248/269 (92%), Gaps = 1/269 (0%) Query: 1 MTASNTPPVFSLHRGSLPLLISIPHLGTQIPADIAATMTPAAQRTDDCDWHLDRLYAFAK 60 MTASNTPPVF+LHRGSLPLLISIPH+GT+IP DIA TMTP A RTDDCDWHLDRLYAFAK Sbjct: 1 MTASNTPPVFTLHRGSLPLLISIPHVGTEIPVDIAGTMTPVAFRTDDCDWHLDRLYAFAK 60 Query: 61 RMGASILAPTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLDGQLPDEAETT 120 RMGASIL PTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYL+G LPDEAE Sbjct: 61 RMGASILMPTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLEGHLPDEAEVA 120 Query: 121 RRRDAYWKPYHEALQGELAALKAKHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGAS 180 RRRDAYW PYH+AL GELAALKA+HGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGAS Sbjct: 121 RRRDAYWVPYHDALAGELAALKARHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGAS 180 Query: 181 AVAGLAEEMAATVEQYDGGYTAVANGRFKGGYITREYGQPSQGVHALQLELSQITYMEEH 240 AVAGL EE+AA VE++ GGY+AVANGRFKGG+ITR YGQPSQGVHA+QLELSQITYM+E Sbjct: 181 AVAGLGEELAAVVERH-GGYSAVANGRFKGGFITRHYGQPSQGVHAVQLELSQITYMQEQ 239 Query: 241 MPYAYDETLAAKVEPLLEALVVKALERVK 269 PYAYDE LAAKVEPLLE LV A ERVK Sbjct: 240 PPYAYDEALAAKVEPLLEQLVATASERVK 268 Lambda K H 0.317 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 270 Length adjustment: 25 Effective length of query: 246 Effective length of database: 245 Effective search space: 60270 Effective search space used: 60270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate H281DRAFT_04867 H281DRAFT_04867 (N-formylglutamate deformylase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.14919.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-109 349.0 0.0 9.8e-109 348.8 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_04867 H281DRAFT_04867 N-formylglutamat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_04867 H281DRAFT_04867 N-formylglutamate deformylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 348.8 0.0 9.8e-109 9.8e-109 3 257 .. 10 263 .. 8 268 .. 0.98 Alignments for each domain: == domain 1 score: 348.8 bits; conditional E-value: 9.8e-109 TIGR02017 3 levqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlv 68 ++++rG++Pllis+Ph Gt+++ +++ ++ a + d+dWh+++ly+fa+ +Ga+++ ++ r+v lcl|FitnessBrowser__Burk376:H281DRAFT_04867 10 FTLHRGSLPLLISIPHVGTEIPVDIAGTMTPVAFRTDDCDWHLDRLYAFAKRMGASILMPTYARYV 75 6899************************************************************** PP TIGR02017 69 idvnrdpsgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierl 134 id+nr+p+ga lypgq ttgl+P +tfd eply +G+ P+eae+++r++ y+ Pyh+al+ e++ l lcl|FitnessBrowser__Burk376:H281DRAFT_04867 76 IDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLEGHLPDEAEVARRRDAYWVPYHDALAGELAAL 141 ****************************************************************** PP TIGR02017 135 ralhgkivlydahsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrf 200 +a hgk++l++ahsirs++Pr+feG+lPdfn Gt +g+s+ +l ++++av+++ g+s v nGrf lcl|FitnessBrowser__Burk376:H281DRAFT_04867 142 KARHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGASAVAGLGEELAAVVERHGGYSAVANGRF 207 ****************************************************************** PP TIGR02017 201 kGGyitrhygqPqngvhavqlelaqrgyleeetePvaydeakaealravlkelleal 257 kGG+itrhygqP++gvhavqlel+q +y++ e+ P+aydea a+++ +l++l+ ++ lcl|FitnessBrowser__Burk376:H281DRAFT_04867 208 KGGFITRHYGQPSQGVHAVQLELSQITYMQ-EQPPYAYDEALAAKVEPLLEQLVATA 263 ******************************.99********************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (270 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.66 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory