Align Histidine ammonia-lyase; Histidase; EC 4.3.1.3 (uncharacterized)
to candidate H281DRAFT_03978 H281DRAFT_03978 histidine ammonia-lyase
Query= curated2:Q73Q56 (507 letters) >FitnessBrowser__Burk376:H281DRAFT_03978 Length = 537 Score = 286 bits (732), Expect = 1e-81 Identities = 171/491 (34%), Positives = 269/491 (54%), Gaps = 12/491 (2%) Query: 6 VTVTGSSLTIEDVVAVARHGAEVKLSADA--KKRIKDSKKIVDDIVKSGKPTYGISTGFG 63 V + G L+IE+VVA+A+H A V L+AD + RI+ + + +G+ YG++TG+G Sbjct: 27 VVIGGRKLSIEEVVAIAQHRAPVALNADPAWRARIQRGADFLRRHLAAGETVYGVNTGYG 86 Query: 64 ELSTVTITKDQNGALQRNLILSHACGVGNPFPEDIVRAIMLLRLNTHASGFSGVTPSVPD 123 + V + + AL L H CG+G + A++ RLN+ A GFSGV P + + Sbjct: 87 DACVVDVPMELVEALPLQLTRYHGCGMGQYLDDAQTLAVIAARLNSLAYGFSGVRPVLLE 146 Query: 124 ILVDMLNKGVIPYVPEKGSLGASGDLANLAHIALVMIGEGKAYYEGKLMEGKAALAKAGL 183 L D++N V+P +P +GS+GASGDL L+++A + GE + +EG+L + + + G Sbjct: 147 RLADLVNHRVLPRIPAEGSVGASGDLTPLSYVAAALAGEREVMFEGRLRDVREVWNELGQ 206 Query: 184 KPVVLSGKDGLGIINGTPVMSGIGALALHDAEQLLKAANMGASLVFEAFRGITAALDPRI 243 P+ L+ K+GL ++NGT VM+G+ LA A+ L + +L A G A D + Sbjct: 207 TPLTLAPKEGLALMNGTAVMTGLACLAFARADHLTRLTARLTALCTVALDGRAAHFDATL 266 Query: 244 HKSRPHKGQIDTAAFILKMLKGSSSINTRENDVQDPYTLRCVPQVHGASADAIAYVRKVL 303 + +PH GQ AA+I + L+G +T + +QD Y++RC P V G + DA+++VR+ + Sbjct: 267 FEVKPHAGQAQAAAWIREDLEGRD--DTPGHRLQDRYSIRCAPHVIGVARDALSWVRRDI 324 Query: 304 EIEINAVTDNPLVFPDNHDVISGGNFHGQPIAITMDFLGIAVSELANISERRIERLVNPQ 363 E E+N+ DNPL+ PDN V+ GGNF+G IA MD L +AV+ LA++ +R++ LV+ Sbjct: 325 ENELNSANDNPLIDPDNERVLHGGNFYGGHIAFAMDSLKVAVANLADLMDRQLALLVDVN 384 Query: 364 LNGGLPAFLI----ENGGVNSGFMIPQYTAASLVSENKVLAHPASVDSITSSGNKEDHVS 419 N GLP L +N GF Q ++++ E PASV S ++ + +D VS Sbjct: 385 FNNGLPRNLTGAAPARAAINHGFKAVQISSSAWTGEALKNTMPASVFSRSTEAHNQDKVS 444 Query: 420 MGTTAARKITEIVKNVRHVLAIEWLTAAQACDLR----GVKKYGKGTGEMMKLIRKHISK 475 MGT A+R +++ V A L QA LR M+ + Sbjct: 445 MGTIASRDCLRVLELTEQVAAAHTLATVQAARLRLRIDSATPVPAALRTFMENVGAQSPF 504 Query: 476 VTEDRILYNDI 486 V EDR L +D+ Sbjct: 505 VDEDRALEHDL 515 Lambda K H 0.316 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 507 Length of database: 537 Length adjustment: 35 Effective length of query: 472 Effective length of database: 502 Effective search space: 236944 Effective search space used: 236944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory