Align HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate H281DRAFT_03484 H281DRAFT_03484 osmoprotectant transport system permease protein
Query= TCDB::Q9KKE2 (285 letters) >FitnessBrowser__Burk376:H281DRAFT_03484 Length = 241 Score = 99.4 bits (246), Expect = 7e-26 Identities = 57/183 (31%), Positives = 103/183 (56%), Gaps = 5/183 (2%) Query: 91 LTMQTLALMLMATIVSVVIGVPMGILVAKSRVVRNITLPVLDVMQTMPS---FVYLIPAL 147 LT++ + ++ + +++V GVP+GI++ + I L ++ T+PS F +IP L Sbjct: 17 LTVEHVEIVGVGVGLAIVTGVPLGIVITANARAAKIVLYFAAILMTIPSVALFGLMIPVL 76 Query: 148 MLFG--LGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVEAATAFGGSPGQILFGVELP 205 + G +G +P ++A +Y+ P++R T I +D + EAA G + Q L+ VE+P Sbjct: 77 SVIGQGIGFLPTVIALFLYSQLPIVRNTYTAITNIDPALREAARGIGMTTRQRLWKVEIP 136 Query: 206 LATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQTLDVGKGLEAGIGIVILAV 265 +A P IMAG+ +++ + + VA+ IGA GLG+ + GI D + + I + +LA+ Sbjct: 137 IALPIIMAGVRMAVVINVGIAAVAAYIGAGGLGKLISRGISQSDPRQLIAGAILVSLLAI 196 Query: 266 VLD 268 D Sbjct: 197 AAD 199 Lambda K H 0.327 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 241 Length adjustment: 25 Effective length of query: 260 Effective length of database: 216 Effective search space: 56160 Effective search space used: 56160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory