GapMind for catabolism of small carbon sources


Aligments for a candidate for acn in Paraburkholderia bryophila 376MFSha3.1

Align Aconitate hydratase A; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC; EC (characterized)
to candidate H281DRAFT_02981 H281DRAFT_02981 aconitase /2-methylcitrate dehydratase (trans-methylaconitate-forming)

Query= SwissProt::Q937N8
         (869 letters)

>lcl|FitnessBrowser__Burk376:H281DRAFT_02981 H281DRAFT_02981
           aconitase /2-methylcitrate dehydratase
          Length = 865

 Score = 1449 bits (3752), Expect = 0.0
 Identities = 718/870 (82%), Positives = 790/870 (90%), Gaps = 6/870 (0%)
















Lambda     K      H
   0.318    0.135    0.398 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 2221
Number of extensions: 82
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 869
Length of database: 865
Length adjustment: 42
Effective length of query: 827
Effective length of database: 823
Effective search space:   680621
Effective search space used:   680621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

Align candidate H281DRAFT_02981 H281DRAFT_02981 (aconitase /2-methylcitrate dehydratase (trans-methylaconitate-forming))
to HMM TIGR02333 (acnD: 2-methylisocitrate dehydratase, Fe/S-dependent (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02333.hmm
# target sequence database:        /tmp/gapView.11492.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02333  [M=858]
Accession:   TIGR02333
Description: 2met_isocit_dHY: 2-methylisocitrate dehydratase, Fe/S-dependent
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
          0 1777.8   0.1          0 1777.6   0.1    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_02981  H281DRAFT_02981 aconitase /2-met

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_02981  H281DRAFT_02981 aconitase /2-methylcitrate dehydratase (trans-methylacon
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1777.6   0.1         0         0       1     858 []       2     859 ..       2     859 .. 1.00

  Alignments for each domain:
  == domain 1  score: 1777.6 bits;  conditional E-value: 0
                                    TIGR02333   1 ntkyrkalpgtdldyfdaraaveaikpgaydklpytsrvlaenlvrrvdpetleaslkqlierkre 66 
                                                  nt+yrk lpgt+ld+fdaraav+ai+ gaydklpytsrvlaenlvrr+dp tl aslkq++erkre
                                                  899*************************************************************** PP

                                    TIGR02333  67 ldfpwyparvvchdilgqtalvdlaglrdaiaekggdpaqvnpvvetqlivdhslaveyggfdpda 132
                                                  ldfpw+parvvchdilgqtalvdlaglrdaia++ggdpa vnpvv+tql+vdhslave+ggfdpda
                                                  ****************************************************************** PP

                                    TIGR02333 133 feknraiedrrnedrfhfinwtkkafknvdvipagngimhqinlekmspvvqvkegvafpdtlvgt 198
                                                  f+knraiedrrnedrf finwtk+af+nvdvip+gngi+hqinle+mspvvqv++gvafpdtlvgt
                                                  ****************************************************************** PP

                                    TIGR02333 199 dshtphvdalgviaigvggleaetvmlgraslmrlpdivgveltgkrqpgitatdivlalteflrk 264
                                                  dshtp vdalgviaigvggleae+vmlgras+mrlpdivgv+ltgk + gitatd+vl+lteflrk
                                                  ****************************************************************** PP

                                    TIGR02333 265 ekvvsayleffgegakaltlgdratisnmtpeygataamfaideqtidylkltgreeeqvklvety 330
                                                  ekvv+ayleffgeg+  ltlgdrati+nm+pe+gataamf+ideqti+ylkltgr++e vklvety
                                                  ****************************************************************** PP

                                    TIGR02333 331 akaaglwadslkkavyervlkfdlssvvrnlagpsnpharlatsdlaakgiakeveeeaeglmpdg 396
                                                  ak aglwadsl +a+yervlkfdls+vvr+lagpsnph+rl+ s+laa+gi+++ve+e+ glmpdg
                                                  ***********************************************************.****** PP

                                    TIGR02333 397 aviiaaitsctntsnprnvvaagllarnanklglkrkpwvksslapgskvvklyleeagllkelek 462
                                                  aviiaaitsctnt nprn++aagllarnan++gl+rkpw k+slapgsk+v lyleeagll+ele+
                                                  ****************************************************************** PP

                                    TIGR02333 463 lgfgivafacttcngmsgaldpviqqeiidrdlyatavlsgnrnfdgrihpyakqaflaspplvva 528
                                                  ****************************************************************** PP

                                    TIGR02333 529 yaiagtirfdiekdvlgvdadgkeirlkdiwpsdeeidavvaaavkpeqfrkvyipmfdle.daqk 593
                                                  yaiagtirfdiekdvlgvdadg+++ lkdiwpsdeeida+va++vkpeqfrkvy+pmf+++ d+q+
                                                  ****************************************************************** PP

                                    TIGR02333 594 kvsplydwrpmstyirrppywegalagertlkgmrplavlgdnittdhlspsnailldsaageyla 659
                                                  k+ plydwrpmstyirrppywegalagertl+gmr lavlgdnittdhlspsnail dsaageyl+
                                                  ****************************************************************** PP

                                    TIGR02333 660 kmglpeedfnsyathrgdhltaqratfanpklfnemvkedgkvkqgslariepegkvtrmweaiet 725
                                                  kmglpeedfnsyathrgdhltaqratfanp l nemv+edgkvk gs+ariepegk+trmweaiet
                                                  ****************************************************************** PP

                                    TIGR02333 726 ymnrkqpliiiagadygqgssrdwaakgvrlagveaivaegferihrtnlvgmgvlplefkpgtnr 791
                                                  ym+rkqpli+iagadygqgssrdwaakgvrlag eaivaegferihrtnlvgmgvlplefkpg+nr
                                                  ****************************************************************** PP

                                    TIGR02333 792 ktlaldgtevydvvgeitpradltlvvtrkngeklevpvtcrldtaeevsvyeaggvlqrfaqdfl 857
                                                   tla+dgte++dv+ge++pr+dltlv++r+ ge++evpvtcrldtaee+s+yeaggvlqrfaqdfl
                                                  *****************************************************************9 PP

                                    TIGR02333 858 e 858
  lcl|FitnessBrowser__Burk376:H281DRAFT_02981 859 E 859
                                                  7 PP

Internal pipeline statistics summary:
Query model(s):                            1  (858 nodes)
Target sequences:                          1  (865 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.02s 00:00:00.05 Elapsed: 00:00:00.05
# Mc/sec: 12.57

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory