Align 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (characterized)
to candidate H281DRAFT_06132 H281DRAFT_06132 acetyl-CoA C-acetyltransferase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2982 (397 letters) >FitnessBrowser__Burk376:H281DRAFT_06132 Length = 395 Score = 536 bits (1382), Expect = e-157 Identities = 275/393 (69%), Positives = 320/393 (81%), Gaps = 1/393 (0%) Query: 3 MSNDPIVIVSAVRTPMGGFQGELKSLTAPQLGAAAIKAAVERAGVASDSVDEVLFGCVLP 62 M+NDPIVIVSA RTPMGGFQGEL LTAP LGA AIKAA+ERAGV+ VDE+ GCVL Sbjct: 1 MNNDPIVIVSAARTPMGGFQGELNLLTAPALGAVAIKAALERAGVSGSQVDELTLGCVLS 60 Query: 63 AGLGQAPARQAALGAGLDKSTRCTTLNKMCGSGMEAAILAHDMLLAGSADVVVAGGMESM 122 AGLGQAPARQAA+ AGL S C+T++K+CGSGM+A ++AHD L AGSA V+VAGGMESM Sbjct: 61 AGLGQAPARQAAIAAGLPLSVHCSTVSKVCGSGMKAVMVAHDALAAGSASVIVAGGMESM 120 Query: 123 SNAPYLLDRARAGYRMGHGRVQDSMFLDGLEDAY-DKGRLMGTFAEDCAETNGFSREAQD 181 SNAPYLL +ARAG RMGH D MF DGLEDAY D+GRLMGTFAEDCAE F+R QD Sbjct: 121 SNAPYLLPKARAGLRMGHAAALDHMFFDGLEDAYFDRGRLMGTFAEDCAERFCFTRGDQD 180 Query: 182 AFAIASTTRAQQAIKDGSFKAEIVPLTVTVGKEQVVISNDEQPPKARLDKIASLKPAFRE 241 ++AIAST +AQQAI+ G+F EI P+TVT + + DEQPPKARLDKI SLK AF++ Sbjct: 181 SYAIASTVKAQQAIESGAFDWEIAPVTVTSKVGEKTVDTDEQPPKARLDKIQSLKAAFKK 240 Query: 242 GGTVTAANSSSISDGAAALVLMRQSQAQKQGLKPLAVIHGHAAFADTPGLFPVAPIGAIK 301 GTVTAANSSSISDGAAALVLMR S A++QGL+PLAV+ GH+ +AD P LF APIGAI+ Sbjct: 241 DGTVTAANSSSISDGAAALVLMRLSTAERQGLQPLAVVVGHSTYADEPRLFTTAPIGAIR 300 Query: 302 KLMKKTGWSLNDVDLVEVNEAFAVVGMAAMTHLEIPHEKLNVHGGACALGHPIGASGARI 361 KL+ +T WS+ DVDL E+NEAFAVV MA L I E++N+HGGACALGHPIGASGARI Sbjct: 301 KLLDRTEWSIGDVDLWEINEAFAVVSMACTKELGIAPERVNIHGGACALGHPIGASGARI 360 Query: 362 LVTLLSALRQKGLKRGVAAICIGGGEATAMAVE 394 LVTLL ALRQ G KRG+A++CIGGGEATA+A+E Sbjct: 361 LVTLLGALRQTGGKRGIASLCIGGGEATAVAIE 393 Lambda K H 0.318 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 395 Length adjustment: 31 Effective length of query: 366 Effective length of database: 364 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory