Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate H281DRAFT_01230 H281DRAFT_01230 3-oxoacyl-[acyl-carrier protein] reductase
Query= BRENDA::Q99714 (261 letters) >FitnessBrowser__Burk376:H281DRAFT_01230 Length = 250 Score = 107 bits (268), Expect = 2e-28 Identities = 84/252 (33%), Positives = 123/252 (48%), Gaps = 20/252 (7%) Query: 10 GLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGN--NCVFAPADVTS 67 G V ITGGA G+G A A+R + GAS L D+ ++L ++T Sbjct: 8 GRVVAITGGARGIGYAVAQRALQSGASVALWDVDAERLARSQRELSEFGKVTAVTVELTQ 67 Query: 68 EKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLED--FQRVLDVNLMGT 125 E V A+ G +DV VNCAGI + G T LE ++RV+DVNL+G Sbjct: 68 ESAVAQAVERTVADHGAIDVLVNCAGITGGN-------GTTWELEPDVWRRVIDVNLIGP 120 Query: 126 FNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARD 185 + R V +M + QG G I+N ASVA EG + YSASK G++G+T + ++ Sbjct: 121 YLTCRAVVPQMLK----QG--YGRIVNIASVAGKEGNPNASHYSASKAGLIGLTKSLGKE 174 Query: 186 LAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLV--QAIIEN 243 LA I V + P T + S+ ++ +++ S++P +R P E A L+ A + Sbjct: 175 LATKNILVNAVTPAAAKTEIFDSMSQQHIDYMLSKIPM-NRFLLPEEAASLILWLASEDC 233 Query: 244 PFLNGEVIRLDG 255 F G V L G Sbjct: 234 AFSTGSVFDLSG 245 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 250 Length adjustment: 24 Effective length of query: 237 Effective length of database: 226 Effective search space: 53562 Effective search space used: 53562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory