GapMind for catabolism of small carbon sources

 

Aligments for a candidate for livJ in Paraburkholderia bryophila 376MFSha3.1

Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate H281DRAFT_04063 H281DRAFT_04063 amino acid/amide ABC transporter substrate-binding protein, HAAT family

Query= uniprot:A0A165KTD4
         (375 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_04063 H281DRAFT_04063 amino
           acid/amide ABC transporter substrate-binding protein,
           HAAT family
          Length = 400

 Score =  374 bits (960), Expect = e-108
 Identities = 189/365 (51%), Positives = 253/365 (69%), Gaps = 4/365 (1%)

Query: 11  AAIAAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGKKIK 70
           AA+AA+A  AS +  VVKIGH AP++G  AH GKDNENGAR+A+EE+NAQG+TI G KI 
Sbjct: 35  AAVAASAAPAS-EAIVVKIGHAAPLTGGIAHLGKDNENGARLAVEEINAQGLTIDGHKID 93

Query: 71  FELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGAATN 130
            +L A+DDAADPK GTA AQKL D  V  VVGHLNSG +IPASK+Y+D  I  ++ ++TN
Sbjct: 94  LQLDAQDDAADPKAGTAVAQKLVDDHVVAVVGHLNSGVSIPASKIYSDASIVQISPSSTN 153

Query: 131 PNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKKTAT 190
           P  T+ G+KTT+R++A D   G  LA YA   L  K +A++DD TAYG+G+AD F KT  
Sbjct: 154 PAYTQQGFKTTYRVVATDAQQGPALANYATKALGAKRIAVVDDATAYGKGLADEFAKTVE 213

Query: 191 AKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQLGMGNVKY 250
           A G K+V  + T D+ATDF AILT IK+ +PDAI +GGMD  GGP  +Q   LG+   K 
Sbjct: 214 ASGAKIVAREATNDRATDFRAILTKIKSVHPDAIMFGGMDATGGPFAKQAAALGI-RAKI 272

Query: 251 FGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYPNQFQVYSPY 310
            GGDG+CT ++ +LA  A  + N++C+E G +L+KM  G  ++ KY  ++    Q+Y+P+
Sbjct: 273 LGGDGVCTDKVGELAGTA--VQNLVCSEAGLALSKMDRGADFEKKYVDRFHTPVQIYAPF 330

Query: 311 TYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTSTIAFEPNGEMKNPAITLYVYKDG 370
           TYDA ++IVDAMKRANS++       +  + + GV   IAF+  G++K  AITLY +KDG
Sbjct: 331 TYDAVYVIVDAMKRANSIEAPKVLAAMPSTDYNGVIGRIAFDDKGDLKEGAITLYDFKDG 390

Query: 371 KKTPL 375
           KK  L
Sbjct: 391 KKAVL 395


Lambda     K      H
   0.315    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 445
Number of extensions: 14
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 375
Length of database: 400
Length adjustment: 30
Effective length of query: 345
Effective length of database: 370
Effective search space:   127650
Effective search space used:   127650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory