GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mcm-large in Paraburkholderia bryophila 376MFSha3.1

Align methylmalonyl-CoA mutase (subunit 2/2) (EC 5.4.99.2) (characterized)
to candidate H281DRAFT_02110 H281DRAFT_02110 methylmalonyl-CoA mutase

Query= BRENDA::O74009
         (563 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02110 H281DRAFT_02110
            methylmalonyl-CoA mutase
          Length = 1132

 Score =  304 bits (779), Expect = 1e-86
 Identities = 206/553 (37%), Positives = 309/553 (55%), Gaps = 41/553 (7%)

Query: 40   TDDGFEIKRIYTP--ADLGEDWNYMEKLGFPGEYPFTRGVYATMYRGRIWTMRQYAGYAT 97
            T  G +++++  P   D GE   ++     PG +PFT GV+         T R +AG   
Sbjct: 584  TLSGTQLRKVALPKFVDHGEILRWLMLDNLPGYFPFTAGVFPFRRENEDPT-RMFAGEGD 642

Query: 98   AEESNKRYKYLLSQGQTG--LSVAFDLPTQLGYDSDH-PLAEGEVGKVGVAIDSLWDMRI 154
               +N+R+K LLS+G     LS AFD  T  G + D  P   G+VG  GV++ +L DM  
Sbjct: 643  PSRTNRRFK-LLSEGMPAKRLSTAFDSVTLYGEEPDERPDIYGKVGNSGVSVATLDDMHA 701

Query: 155  LFDGIPL--DKVSTSMTINSTAANLLAMYILVAEEQGVSQ-------------------- 192
            L+DG  L   + S SMTIN  A  +LAM+  VA +Q +++                    
Sbjct: 702  LYDGFDLCAPQTSVSMTINGPAPTILAMFFNVAIDQQIARQAQQLGRALSEDELAETRRM 761

Query: 193  --EKLRGTVQNDILKEYIARGTYIFPPQPSMRLTTDIIMYCAEN-VPKWNPISISGYHIR 249
              E +RGTVQ DILKE   + T IF  + S+++  DI  Y  E+ V  +  +SISGYHI 
Sbjct: 762  ALENVRGTVQADILKEDQGQNTCIFSTEFSLKVMGDIQAYFVEHRVRNFYSVSISGYHIA 821

Query: 250  EAGANAVQEVAFTLADGIEYVKAVIERGMDVDKFAPRLSFFFAAHNNFLEEIAKF-RAAR 308
            EAGAN + ++A+TLA+G  YV+A + RGM +D FAP LSFFF+  N    E     R AR
Sbjct: 822  EAGANPISQLAYTLANGFTYVEAYLARGMSIDDFAPNLSFFFS--NGMDPEYTVLGRVAR 879

Query: 309  RLWAYIMKEWFNAKNPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVLGGTQSLH 368
            R+WA  M+E + A N RS  L++H QT+G +L AQ+ + N +R  +QAL A+     SLH
Sbjct: 880  RVWAIAMRERYGA-NERSQKLKYHVQTSGRSLHAQEIDFNDIRTTLQALIAIYDNCNSLH 938

Query: 369  TNSYDEALSLPTEKSVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYI 428
            TN++DEA++ PTE+SVR A+  Q II  E G+    +P  G++ I+ LTD + E  L   
Sbjct: 939  TNAFDEAITTPTEESVRRAVAIQLIINREWGLAKNQNPNQGSFVIDELTDLVEEAVLAEF 998

Query: 429  EKIQKMGGMMRAIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAFVTDEPIEVEI-LKV 487
            +++ + GG++ A+E GY +  I + +  Y+    +G   IVGVN FV+ +P E    + +
Sbjct: 999  DRLTERGGVLGAMETGYQRGRIQDESMLYEHRKHDGSYPIVGVNTFVSAKPHEAPTPIAL 1058

Query: 488  DPSIREKQIERLKKLR--SERDNKKVQEALDKLRNAAEKEDENLMPYIIEAHRHLATLQE 545
              S  E++  +LK+LR    R       AL++L+ A   +DEN+   +++  R + +L +
Sbjct: 1059 ARSTEEEKQSQLKRLRDFQARHRGAAPAALERLQRAV-IDDENVFAVLMDVVR-VCSLGQ 1116

Query: 546  VTDVLREIWGEYR 558
            +T  L E+ G+YR
Sbjct: 1117 ITHALFEVGGQYR 1129


Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1202
Number of extensions: 60
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 563
Length of database: 1132
Length adjustment: 41
Effective length of query: 522
Effective length of database: 1091
Effective search space:   569502
Effective search space used:   569502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory