Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate H281DRAFT_02384 H281DRAFT_02384 amino acid/amide ABC transporter ATP-binding protein 2, HAAT family
Query= TCDB::Q8YT15 (247 letters) >FitnessBrowser__Burk376:H281DRAFT_02384 Length = 254 Score = 212 bits (539), Expect = 7e-60 Identities = 113/247 (45%), Positives = 164/247 (66%), Gaps = 16/247 (6%) Query: 10 PLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLL--TPHT- 66 P+L+V + Y K V+ L G +V +G++V+VIGPNGAGKSTL I G L T H Sbjct: 10 PILDVNGLSVRYGK-VEALHGAAIKVRAGQIVSVIGPNGAGKSTLLNAIMGALPTTGHAK 68 Query: 67 GKITFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRN--------DS 118 G + ++G++++ + + V GMC VP+ +F S+SVE+NL +GA+ R D Sbjct: 69 GAVVYQGEDVSAVPVEKRVARGMCLVPEKRELFASMSVEDNLVLGAYRRKRAGERNFLDQ 128 Query: 119 LQPLKDKIFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPIL 178 ++P +F +FPRL +RR+Q AGTLSGGERQMLA+G+ALM +P LL+LDEPS L+P++ Sbjct: 129 MEP----VFQLFPRLKERRKQAAGTLSGGERQMLAVGRALMGKPDLLMLDEPSLGLAPLI 184 Query: 179 VTQVFEQVKQINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAE 238 V ++F + + Q G A +L+EQNAR AL+++D GYVLE+G A+ G +L +P+V E Sbjct: 185 VKEIFHIISALRQTGVATLLIEQNARAALQISDYGYVLETGELALEGAASDLAQNPRVIE 244 Query: 239 LYLGAGK 245 YLG K Sbjct: 245 TYLGLAK 251 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 254 Length adjustment: 24 Effective length of query: 223 Effective length of database: 230 Effective search space: 51290 Effective search space used: 51290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory