Align 2-methylisocitrate lyase; 2-MIC; MICL; EC 4.1.3.30; (2R,3S)-2-methylisocitrate lyase (uncharacterized)
to candidate H281DRAFT_06209 H281DRAFT_06209 carboxyvinyl-carboxyphosphonate phosphorylmutase
Query= curated2:Q9YFM7 (308 letters) >FitnessBrowser__Burk376:H281DRAFT_06209 Length = 290 Score = 212 bits (540), Expect = 7e-60 Identities = 115/276 (41%), Positives = 167/276 (60%), Gaps = 3/276 (1%) Query: 13 GLVLRELIEKRDIVVAPGVYNPAVALLAERMGFEALYLSGAAITGS-LAMPDLGLITLSE 71 G LR ++ ++ PGV N A +AE G+ A++++GA I S L PD+GL T++E Sbjct: 6 GAFLRRTLQPSAALLLPGVSNALAARIAEEAGYAAVFVTGAGIANSYLGAPDIGLTTVTE 65 Query: 72 LAMFTSYITRVVRVPVIVDADTGFGEAINVERTVRELERAGAAAIQIEDQVMPKKCGHLQ 131 + + I V +P+I DADTGFG A+NV RTVR ERAGA I +EDQ PK+CGH + Sbjct: 66 VGAHINAIREAVSIPIIADADTGFGNALNVMRTVRLFERAGANCIMLEDQTFPKRCGHFE 125 Query: 132 GKALISPEDMVKKIIAAVGAR--RDALIVARTDARGVEGFEKAVERAQLYVEAGADIIFP 189 GKA++S E+M KI AAV AR D LI+ARTD+R +EGFE+++ER + Y +AGAD++F Sbjct: 126 GKAVVSIEEMTAKIKAAVDARANADTLIMARTDSRAIEGFERSLERIRTYRDAGADVLFV 185 Query: 190 EALTSLEEFREFARRVKAPLLANMTEFGKTPYITVDQFREAGYKIVIFPVTTFRASLKAS 249 EA +SLEE R + NM GKTP + Q E GY VI+ +A++ A Sbjct: 186 EAPSSLEELARIPREAPGVQVCNMVIGGKTPLLPQAQLSELGYAGVIYANAALQAAMFAM 245 Query: 250 ETVLREIMEKGTQKDILDKLYTRTEFYDLIGYHDYE 285 + VL + G+ + D++ + E ++ + Y+ Sbjct: 246 KNVLEHLRSHGSIEGREDQIMSFAERQKMVNFARYD 281 Lambda K H 0.321 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 290 Length adjustment: 27 Effective length of query: 281 Effective length of database: 263 Effective search space: 73903 Effective search space used: 73903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory