Align GtsC (GLcG), component of Glucose porter, GtsABCD (characterized)
to candidate H281DRAFT_00168 H281DRAFT_00168 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= TCDB::Q88P36 (281 letters) >FitnessBrowser__Burk376:H281DRAFT_00168 Length = 285 Score = 369 bits (947), Expect = e-107 Identities = 185/284 (65%), Positives = 225/284 (79%), Gaps = 9/284 (3%) Query: 7 KPVLSLSRMAIHAVLLIAVLLYLVPLVVMLLTSFKTPEDITTGNLLSWPAVITGIGWVKA 66 +P +++SR I+A L++ L +L PL VML TSFK + + TGNLL+ P+ T W+KA Sbjct: 2 QPKMTISRAVIYAALVLFALYFLFPLYVMLSTSFKDIDQLRTGNLLTPPSHWTVEPWIKA 61 Query: 67 W-GAVSG--------YFWNSIMITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFG 117 W GA +G +F NS+ + +PAVL+S+ IGA NGYVL+ WRFRG+ F +LL G Sbjct: 62 WSGACTGVRCDGMQPFFMNSVRMVIPAVLLSSIIGAFNGYVLTHWRFRGADPIFTMLLVG 121 Query: 118 CFLPFQTVLLPASFTLGKLGLASTTGGLVLVHVVYGLAFTTLFFRNFYVSIPDALVKAAR 177 CF+PFQ +LLP + G LGL++TT GLV+VHV+YG+AFTT+FFRNFYVSIP LVKAAR Sbjct: 122 CFIPFQAILLPMARFEGFLGLSNTTTGLVVVHVIYGIAFTTMFFRNFYVSIPAELVKAAR 181 Query: 178 LDGAGFFTIFRRIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVN 237 +DGAGFFTIF +I+LP+S PI MVCLIWQFTQIWNDFLFG+VFS DS PITVALNNLVN Sbjct: 182 IDGAGFFTIFTKILLPVSLPIFMVCLIWQFTQIWNDFLFGIVFSGVDSMPITVALNNLVN 241 Query: 238 TSTGAKEYNVDMAAAMIAGLPTLLVYVVAGKYFVRGLTAGAVKG 281 TSTG KEYNVDMA A+IA LPTLLVY+VAG+YFVRGLTAGAVKG Sbjct: 242 TSTGVKEYNVDMAGAIIAALPTLLVYIVAGRYFVRGLTAGAVKG 285 Lambda K H 0.329 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 285 Length adjustment: 26 Effective length of query: 255 Effective length of database: 259 Effective search space: 66045 Effective search space used: 66045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory