Align Sugar ABC transporter permease (characterized, see rationale)
to candidate H281DRAFT_01452 H281DRAFT_01452 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= uniprot:A0A165KQ00 (289 letters) >FitnessBrowser__Burk376:H281DRAFT_01452 Length = 305 Score = 300 bits (769), Expect = 2e-86 Identities = 143/274 (52%), Positives = 198/274 (72%) Query: 16 VYAVLALATAFFLLPLYAMLVTSFKYAEEIRSTSLLALPGSLNWSAWGTAWQSACTGVDC 75 VY L A FFLLPLY MLVTSFK EIR +LLALP AW AW+SACTG+DC Sbjct: 32 VYLFLLSAALFFLLPLYVMLVTSFKPMSEIRLGNLLALPAHFTLHAWSAAWESACTGLDC 91 Query: 76 NGLRPFFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMPFQVVLL 135 NG++ F NSV + VP+ + S GA+NGY LS W+ RG+ LFG+LL G F+P QV++ Sbjct: 92 NGIQVGFWNSVRIVVPSTVFSIAIGAVNGYALSFWRPRGAGVLFGVLLMGAFIPVQVMVY 151 Query: 136 PMSQVLGWLGLSSSITGLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARMDGASFFQIF 195 P+ +VL + L SS+ G+V++H + G+ TL FRNYYA+IP+EL AAR+DG F++IF Sbjct: 152 PLVRVLASVHLFSSLPGIVVIHTIFGMPVMTLLFRNYYASIPQELFKAARIDGGGFWRIF 211 Query: 196 WRIVLPLSTPIVMVTLIWQFTNIWNDFLFGVVFSGTDSKPVTVGLNNLANTSSSVKAYNV 255 +++LP+STPI++V +I Q T IWNDF+ G+VF+GT + P+TV LNN+ NT++ + YNV Sbjct: 212 VQLMLPMSTPIIVVAVIMQVTGIWNDFILGLVFAGTKNLPMTVQLNNIINTTTGERLYNV 271 Query: 256 DMAAAIIAGLPTMVIYVLAGKFFVRGLTAGAVKG 289 +MAA I+ L + +Y ++G++FVRG+ +GAVKG Sbjct: 272 NMAATILTSLVPLAVYFISGRWFVRGIASGAVKG 305 Lambda K H 0.327 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 305 Length adjustment: 26 Effective length of query: 263 Effective length of database: 279 Effective search space: 73377 Effective search space used: 73377 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory