Align ABC transporter for Lactose, permease component 1 (characterized)
to candidate H281DRAFT_03746 H281DRAFT_03746 carbohydrate ABC transporter membrane protein 1, CUT1 family
Query= reanno::Smeli:SM_b21653 (298 letters) >FitnessBrowser__Burk376:H281DRAFT_03746 Length = 296 Score = 149 bits (375), Expect = 1e-40 Identities = 99/284 (34%), Positives = 149/284 (52%), Gaps = 9/284 (3%) Query: 17 WLFVAPALGLITLFMVYPIAWSLWMSFQ--SGRGMTLKFAGFANIVRLWNDPVFIKALTN 74 WL +AP+L L + YPI +W S S G F G N ++ DP F+ A Sbjct: 13 WLLIAPSLVLALFIISYPIFNIVWQSLHEVSRFGAIRDFTGLQNFYTIFGDPAFLAAARR 72 Query: 75 TMTYFVVQVPIMILLALILASLLNNPRLVGRGVFRTAIFLPCVSSLVAYSVLFKGMFATD 134 T+ + V V +L+++ +A +LN GRGV RT + LP SL +V+++ F D Sbjct: 73 TIVWTVFVVGGTVLISVPVALVLNQD-FYGRGVARTIVMLPWSVSLTMTAVVWRWAFNDD 131 Query: 135 -GIVNSTLQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFYLAALQNIDKSIYE 193 G+VN TLQ +GL PI WL P +A + I + + L L ++ IYE Sbjct: 132 YGMVNVTLQRLGLIGGPIHWLATPEFAFPVEIAVGILVSIPFTVTILLGGLSSVPGDIYE 191 Query: 194 VARIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLTEGKGGPSNATLTL 253 ARIDG AW + LT+PLL+P I T +++ I F ++ +T+ GGP N+T L Sbjct: 192 AARIDGASAWQQFRKLTLPLLRPFINMTILLNVIYVFNSFPIIWVMTQ--GGPDNSTHIL 249 Query: 254 SLYIYNLTFRFMPNLGYAATVSYVIVVL--VALLAFVQFFAARE 295 Y+Y L FR + G AA VS +++V+ V +A+++ A+E Sbjct: 250 VTYLYELGFR-LGRPGEAAAVSLIMLVMLFVFSMAYLRLQPAKE 292 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 296 Length adjustment: 26 Effective length of query: 272 Effective length of database: 270 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory