Align LacG, component of Lactose porter (characterized)
to candidate H281DRAFT_03232 H281DRAFT_03232 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= TCDB::P29824 (273 letters) >FitnessBrowser__Burk376:H281DRAFT_03232 Length = 283 Score = 140 bits (354), Expect = 2e-38 Identities = 78/256 (30%), Positives = 137/256 (53%), Gaps = 5/256 (1%) Query: 18 LSLAAFLSIFPFIWMVIGTTNTTSQIIRGKVTFGT---ALFDNIASFFAQVDVPLVFWNS 74 L +A + + P I +++ + ++ ++ G ALFDN + FWNS Sbjct: 21 LPIALLIWLLPMIAVLVTSIRSSEELSEGNYWGWPKHFALFDNYREALTTSPMLHYFWNS 80 Query: 75 VKIALVGTALTLLVSSLAGYGFEMFRSKLRERVYTVILLTLMVPFAALMIPLFMLMGQAG 134 V I + ++ ++++AG+ ++R + ++ + VP LMIP+ L Q G Sbjct: 81 VLITVPAVIGSIALAAMAGFALAIYRFRGNSSLFATFVAGNFVPVQVLMIPVRDLSLQLG 140 Query: 135 LLNTHIAIMLPMIA--SAFIIFYFRQASKAFPTELRDAAKVDGLKEWQIFFYIYVPVMRS 192 + NT A++L ++ + F + R K P EL +AA+++G EW +FF I +P++R Sbjct: 141 VFNTVSALILFHVSFQTGFCALFLRNFIKQLPFELVEAARIEGANEWTVFFRIVLPLIRP 200 Query: 193 TYAAAFVIVFMLNWNNYLWPLIVLQSNDTKTITLVVSSLASAYSPEYGTVMIGTILATLP 252 AA ++VF WN+Y W L + Q +D IT+ V++L ++ + V G+ILA LP Sbjct: 201 ALAALAILVFTFVWNDYFWALCLTQGDDAAPITVGVAALKGQWTTAWNLVSAGSILAALP 260 Query: 253 TLLVFFAMQRQFVQGM 268 ++ +FFAMQ+ FV G+ Sbjct: 261 SVAMFFAMQKHFVAGL 276 Lambda K H 0.331 0.140 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 283 Length adjustment: 25 Effective length of query: 248 Effective length of database: 258 Effective search space: 63984 Effective search space used: 63984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory