GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacZ in Paraburkholderia bryophila 376MFSha3.1

Align Exo-alpha-(1->6)-L-arabinopyranosidase; APY; Beta-D-galactopyranosidase; EC 3.2.1.- (characterized)
to candidate H281DRAFT_00016 H281DRAFT_00016 beta-glucosidase

Query= SwissProt::E7CY69
         (757 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_00016 H281DRAFT_00016
           beta-glucosidase
          Length = 763

 Score =  302 bits (774), Expect = 4e-86
 Identities = 225/702 (32%), Positives = 331/702 (47%), Gaps = 62/702 (8%)

Query: 23  GGDAWHLQGVESKGIPSYMITDGPHGLRKSLASSAGETDLDDSVPATCFPPAAGLSSSWN 82
           G    H+ G+ +  IP++ IT+GP G+        G  D      AT  P +  L++S++
Sbjct: 88  GNSIRHIPGIPALSIPTFRITNGPVGI--------GAGDCVPQDRATALPMSMALAASFD 139

Query: 83  PELIHKVGEAMAEECIQEKVAVILGPGVNIKRNPLGGRCFEYWSEDPYLAGHEAIGIVEG 142
           P L    G+ +  E     + V+  PG+N  R   GGR FEY SEDP LAG  A   + G
Sbjct: 140 PTLARAYGDVLGREARMLGLHVVEAPGMNAVRVGQGGRNFEYLSEDPVLAGVIAENEIRG 199

Query: 143 VQSKGVGTSLKHFAANNQETDRLRVDARISPRALREIYFPAFEHIVKKAQPWTIMCSYNR 202
            Q+ GV    KHF  N QE +R  V   +  R L EIY   F   V++    ++MCSYNR
Sbjct: 200 AQATGVIAMAKHFILNEQEANRNTVSVVVDDRTLHEIYLLPFGVSVRRGNVASVMCSYNR 259

Query: 203 INGVHSAQNHWLLTDVLRDEWGFDGIVMSDWGADHDRGASLNAGLNLEMPPS--YTDDQI 260
           I   ++ +    L  +LR E GF G V SD+GA H    +LNAGL+LEM     +T   +
Sbjct: 260 IGSTYACETPRALNAILRGELGFMGYVQSDFGATHSTAPALNAGLDLEMQSGIWFTPPNL 319

Query: 261 VYAVRDGLITPAQLDR------MAQGMIDLVNKTRAAMSIDNYRFDVDAHDEVAHQAAIE 314
             A+  G +T A +++             + ++  A   +D+     D  +  A     +
Sbjct: 320 NAALATGQLTMATVNQALTRRYTQMFKAGIFDRPVARTPLDSTTIQNDGTE--ARVIGEQ 377

Query: 315 SIVMLKNDDAILPLNAGPVANPSATPQKIAVIGE--FARTPRYQGGGSSHITPT----KM 368
           S V+LKN   +LPL        S   + I ++G   +       G GSS + PT      
Sbjct: 378 SAVLLKNSGNLLPL--------SGAVKSITIVGHNTYVDDAIAGGSGSSRVVPTYTVGPQ 429

Query: 369 TSFLDTLAERGIKADFAPGFTLDLEPADPALESEAVETAKNADVVLMFLGLPEAVESEGF 428
               + L + G  A      TL   P D ++++     A  ADV ++  G+   V  EG 
Sbjct: 430 QGITNVLRQLGSSATVK---TL-AAPNDGSMDAAVAAAAATADVAIVMAGV---VTGEGS 482

Query: 429 DRDTLDMPAKQIALLEQVAAANQNVVVVLSNGSVITVAPWAKNAKGILESWLLGQSGGPA 488
           DR  L +P  Q  L+  VA  N+  +VVL +G  + + PW      ILE+W  GQ  G  
Sbjct: 483 DRPDLSLPKGQDKLIAAVANRNERTIVVLKDGDPV-LMPWVDQVPAILETWYSGQEDGNV 541

Query: 489 LADVIFGQVSPSGKLAQSIPLDINDDPSML--NWPGEEGH---VDYGEGVFAGYRYYDTY 543
           +A ++FG  +PSGKL  + P    D P+ +   +PG  G    V Y EG+  GYR+YDT 
Sbjct: 542 VARLLFGLANPSGKLPVTYPRLATDTPTSMPDRYPGTSGSDPVVQYSEGLLVGYRWYDTR 601

Query: 544 GKAVDYPFGYGLSYATFEITGVAVAK---TGANTATVTATVTNTSDVDAAETVQVYV-VP 599
                + FG+GLSY +F+I+ V V+    TG     V  TV NT   + AE  QVY+ +P
Sbjct: 602 QVKPLFAFGHGLSYTSFKISDVQVSPRGYTGNGPILVALTVENTGLREGAEVAQVYLGLP 661

Query: 600 GKADVARPKHELKGFTKAFLKAGESKTVAIDL----DERAFAYWSEKYNDWHVEAGEYAI 655
              ++  P   L  F K  LK GE + +++ +       A +YW      W + AG Y +
Sbjct: 662 --PNLGEPTKRLIAFQKVLLKPGEKRALSMYIYPINGFHALSYWDNAAQSWKIAAGTYTV 719

Query: 656 EVGVSSRDIAD----TVAVAL--DGDGKTQPLTEWSTYG-EW 690
            VG +S +I      TV VA+   GDG      + + +G +W
Sbjct: 720 YVGNASDNIVAQSTFTVNVAMRDTGDGDDNVSRDPAPFGWDW 761


Lambda     K      H
   0.315    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1271
Number of extensions: 59
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 757
Length of database: 763
Length adjustment: 40
Effective length of query: 717
Effective length of database: 723
Effective search space:   518391
Effective search space used:   518391
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory