Align β-glycosidase (β-gly) (EC 3.2.1.21|3.2.1.23) (characterized)
to candidate H281DRAFT_01455 H281DRAFT_01455 beta-glucosidase
Query= CAZy::ABI35984.1 (431 letters) >FitnessBrowser__Burk376:H281DRAFT_01455 Length = 464 Score = 398 bits (1023), Expect = e-115 Identities = 212/426 (49%), Positives = 273/426 (64%), Gaps = 16/426 (3%) Query: 6 EKFLWGVATSAYQIEGATQEDGRGPSIWDAFARRPGAIRDGSTGEPACDHYRRYEEDIAL 65 + FL G AT++YQIEGA EDGR PSIWD F PG + G +G ACDHY R+E D+ + Sbjct: 26 KNFLLGAATASYQIEGAVDEDGRLPSIWDTFCATPGKVLAGDSGAVACDHYHRWESDVDM 85 Query: 66 MQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLA 125 + LG+ YR S+AWPR++ + G N KGL FY RL+ RL GIT F+TLYHWDLP Sbjct: 86 LVGLGLEGYRLSIAWPRVM-DANGASNRKGLDFYKRLLTRLKEKGITTFVTLYHWDLPQH 144 Query: 126 LEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNL 185 LE+RGGW +RETA+ FA+YA+ ++R LA V +ATLNEPWCSA+LG+ G HAPGL N Sbjct: 145 LEDRGGWLNRETAYRFADYADLMSRELAGTVDAWATLNEPWCSAYLGYGNGHHAPGLANG 204 Query: 186 EAALRAAHHLLLGHGLAVEALRAAG-ARRVGIVLNFAPAYG-----EDPEAVDVADRYHN 239 A +A HHLLL HGLA+ LR + + GIV N ED A + + HN Sbjct: 205 RFATQAMHHLLLAHGLALPVLRENDPSSQKGIVANIGRGTPNSDSVEDQRAAQLFEIQHN 264 Query: 240 RYFLDPILGKGYPESPFRDPPPVP--ILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLP 297 + LDP+L YPE+ F P IL D+++++ PLDFLG+NYY VA G Sbjct: 265 AWILDPLLKGAYPEALFELWPGTEPLILGGDMQIISAPLDFLGINYYFRTNVAT-DGAHG 323 Query: 298 VRYLPPEG-PATAMGWEVYPEGLHHLLKRLGRE---VPWPLYVTENGAAYPDLWTGEAVV 353 +P EG T MGWEVYP+GL LL E +P P+Y+TENG A D + V Sbjct: 324 FTEVPLEGVERTQMGWEVYPDGLRDLLIGFSHEYSNLP-PVYITENGMASDDT-VIDGRV 381 Query: 354 EDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRR 413 D +R+++L+ H+ A A + GVD+RGYF+WSLMDNFEWAFGY RRFG+ +VD+ +Q+R Sbjct: 382 NDTQRISFLKRHLAAVDEAIKAGVDIRGYFLWSLMDNFEWAFGYERRFGIVHVDYVTQKR 441 Query: 414 IPKRSA 419 KRSA Sbjct: 442 TTKRSA 447 Lambda K H 0.322 0.140 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 26 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 464 Length adjustment: 33 Effective length of query: 398 Effective length of database: 431 Effective search space: 171538 Effective search space used: 171538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory