GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuA in Paraburkholderia bryophila 376MFSha3.1

Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate H281DRAFT_01346 H281DRAFT_01346 isovaleryl-CoA dehydrogenase

Query= reanno::acidovorax_3H11:Ac3H11_2991
         (396 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_01346 H281DRAFT_01346
           isovaleryl-CoA dehydrogenase
          Length = 393

 Score =  646 bits (1666), Expect = 0.0
 Identities = 316/391 (80%), Positives = 349/391 (89%)

Query: 5   ANLPGLNFQLGEDIDALRDAVRDFAQAEIAPRAADIDKSDQFPMDLWRKMGDLGVLGITV 64
           +NLPGL F LGE+I+ LRD++  FA  EIAPRAA+ID++DQFPMDLWRK GDLGVLG+TV
Sbjct: 2   SNLPGLQFPLGEEIEMLRDSIAGFAAKEIAPRAAEIDRTDQFPMDLWRKFGDLGVLGMTV 61

Query: 65  PEQYGGAAMGYLAHMVAMEEISRASASVGLSYGAHSNLCVNQINRNGNEAQKAKYLSKLI 124
            E+YGGA MGY AHMVAMEEISRASASVGLSYGAHSNLCVNQI+RNG EAQK KYL KL+
Sbjct: 62  SEEYGGANMGYTAHMVAMEEISRASASVGLSYGAHSNLCVNQIHRNGTEAQKQKYLPKLV 121

Query: 125 SGEHVGALAMSEPGAGSDVISMKLKAEDKGGYYLLNGSKMWITNGPDADTLVVYAKTEPE 184
           SGEHVGALAMSEP AGSDV+SMKL+A+ KG  Y+LNG+KMWITNGPD DTLVVYAKT+ E
Sbjct: 122 SGEHVGALAMSEPNAGSDVVSMKLRADRKGDRYVLNGTKMWITNGPDCDTLVVYAKTDVE 181

Query: 185 LGARGVTAFLIEKGMKGFSIAQKLDKLGMRGSHTGELVFQDVEVPAENVLGGLNQGAKVL 244
             +RG+TAF++EKGMKGFS+AQKLDKLGMRGSHTGELVFQDVEVP EN+LG LN G KVL
Sbjct: 182 ANSRGITAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFQDVEVPEENILGQLNGGVKVL 241

Query: 245 MSGLDYERAVLTGGPLGIMQSVMDNVIPYIHDRKQFGQSIGEFQLIQGKVADMYTVLQAG 304
           MSGLDYERAVL GGP GIM +VMD V+PYIHDRKQFGQSIGEFQLIQGKVAD+YT LQA 
Sbjct: 242 MSGLDYERAVLAGGPTGIMVAVMDAVVPYIHDRKQFGQSIGEFQLIQGKVADLYTTLQAC 301

Query: 305 RSFAYTVAKNLDMLGTDHVRQVRKDCASVILWCAEKATWMAGEGVQIYGGNGYINEYPLG 364
           R++ Y V + LD LGT HVRQVRKDCA VIL+ AEKATWMAGE +QI GGNGYINEYP+G
Sbjct: 302 RAYLYAVGRQLDTLGTAHVRQVRKDCAGVILYTAEKATWMAGEAIQILGGNGYINEYPVG 361

Query: 365 RLWRDAKLYEIGAGTSEIRRMLIGRELFAET 395
           RLWRDAKLYEIGAGTSEIRRMLIGRELFAET
Sbjct: 362 RLWRDAKLYEIGAGTSEIRRMLIGRELFAET 392


Lambda     K      H
   0.318    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 607
Number of extensions: 13
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 396
Length of database: 393
Length adjustment: 31
Effective length of query: 365
Effective length of database: 362
Effective search space:   132130
Effective search space used:   132130
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory