Align 3-methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate H281DRAFT_01344 H281DRAFT_01344 methylglutaconyl-CoA hydratase
Query= metacyc::MONOMER-16071 (271 letters) >FitnessBrowser__Burk376:H281DRAFT_01344 Length = 261 Score = 198 bits (503), Expect = 1e-55 Identities = 107/246 (43%), Positives = 148/246 (60%) Query: 17 ATLWLSREDKNNAFNAQMIRELIVAIDQLAEDASLRFVLLRGRGRHFSAGADLAWMQQSA 76 AT+ L+R D NAFN MI EL A L +R V+L G+ F AGADL WM++ A Sbjct: 15 ATVTLNRPDVRNAFNETMIAELTSAFTALDTRDDVRAVVLAANGKAFCAGADLNWMKKMA 74 Query: 77 QLDFNTNLDDAHELGELMYALHRLKAPTLAVVQGAAFGGALGLISCCDMAIGAEDAQLCL 136 N DA L ++ +++R P +A V G A+ G +GLIS CD+ + E A+ CL Sbjct: 75 AYSDEENRADAMLLANMLSSIYRCSKPVIARVNGDAYAGGMGLISACDIVVAVESARFCL 134 Query: 137 SEVRIGLAPAVISPFVVKAIGERAARRYALTAERFTGVRARELGLLAEVYPASELDDHVE 196 SE R+GL PA I+P+VV+A+GE+A+RRY +TAE+F A LG + E A +LD V+ Sbjct: 135 SEARLGLIPATIAPYVVRALGEQASRRYFITAEQFDCATALRLGFVGEAVSAGQLDATVQ 194 Query: 197 AWVSNLLQNSPQALRATKDLLREVDDGELSPALRRYCENTIARIRVSAEGQEGLRAFLEK 256 L N PQA+R K L++++ +L+ AL IAR R AEG+EG+ +FLEK Sbjct: 195 QIAQTLCANGPQAVRNCKRLVQDMAGRKLNDALIEDTAARIARTRAGAEGREGVASFLEK 254 Query: 257 RRPAWQ 262 R PAW+ Sbjct: 255 RTPAWR 260 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 261 Length adjustment: 25 Effective length of query: 246 Effective length of database: 236 Effective search space: 58056 Effective search space used: 58056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory