Align 3-hydroxy-3-methylglutaryl-coenzyme A lyase/3-methylglutaconyl-coenzyme A hydratase; EC 4.1.3.4; EC 4.2.1.18 (characterized)
to candidate H281DRAFT_03708 H281DRAFT_03708 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)
Query= CharProtDB::CH_122457 (599 letters) >FitnessBrowser__Burk376:H281DRAFT_03708 Length = 328 Score = 173 bits (439), Expect = 9e-48 Identities = 108/286 (37%), Positives = 149/286 (52%), Gaps = 8/286 (2%) Query: 8 VRIVEVGPRDGLQNIPQSIDSTIKLDLIRRLRDAGLQTIELTSFVSPRAIPQLADAQVVV 67 V I EVGPRDGLQ+I + + KL I L AGL+ IE+ SFV R +PQ+AD + VV Sbjct: 9 VMISEVGPRDGLQSIKSIMPTQAKLRWISALAAAGLKEIEVGSFVPARLLPQMADIRDVV 68 Query: 68 QNADIQKLLKNPKLRLPVLVPNLKGLERALHNGIKEVAVFISATEGFSRANINCTVDEGL 127 +A L P L + VL PNL+G A + + +V + +S T S ANI + + + Sbjct: 69 AHA-----LTIPGLHVAVLAPNLRGCRAAFESSVHKVTLPVSVTNEHSMANIRKSTGQMI 123 Query: 128 ERARQVASRAASA--GLSVRGYVSCIFADPYDGPTRPSSVLRCTKALLDAGCYEVSLGDT 185 E RQ+ + G+++ VS F G +R A+ + G E+ L DT Sbjct: 124 EEVRQIVALRDGEFPGIAIEAGVSVAFGCTIAGSVSDDETIRMCAAMAECGVDEIGLSDT 183 Query: 186 LGIGTPADVRWLITYLQDNGVPLEMLAGHFHDTYGGAVANVWEAYKCGLRMFDSSVAGLG 245 G P VR L LQ + HFH+T G +ANV A + G++ DSS AGLG Sbjct: 184 SGYANPTQVRRLFRRLQSE-FGSKAGGAHFHNTRGQGLANVVAALEAGVKTIDSSQAGLG 242 Query: 246 GCPXALGAKGNVASEDLVYMFERSGIHTGVDLSKLVETGEWISRQL 291 GCP A GA GN+ +EDL ++ E G TG+D+ LV +S L Sbjct: 243 GCPYAPGATGNIVTEDLAFLLESMGHDTGIDIDALVAARSILSEAL 288 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 599 Length of database: 328 Length adjustment: 32 Effective length of query: 567 Effective length of database: 296 Effective search space: 167832 Effective search space used: 167832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory