Align D-lysine oxidase (EC 1.4.3.3) (characterized)
to candidate H281DRAFT_05881 H281DRAFT_05881 D-amino-acid dehydrogenase
Query= metacyc::G1G01-3833-MONOMER (414 letters) >FitnessBrowser__Burk376:H281DRAFT_05881 Length = 414 Score = 421 bits (1081), Expect = e-122 Identities = 222/415 (53%), Positives = 266/415 (64%), Gaps = 5/415 (1%) Query: 1 MHCQTLVLGAGIVGVSTALHLQARGRQVILIDRDEPGSGTSHGNAGLIERSSVIPYAFPR 60 M +VLG GIVGVS ALHLQ RGR+V L+DR PG TS GNAGLIER++V+PY FPR Sbjct: 1 MDFDVIVLGGGIVGVSCALHLQDRGRRVALVDRRAPGEETSFGNAGLIERAAVVPYGFPR 60 Query: 61 QLSALLRYGLNRQPDVRYSLAHLPKAAPWLWRYWRQSAPGRLAGAAADMLPLVQRCVDEH 120 L LLR+ NR D+ + +P A WL R+W +S+ RL AA DMLPL++R V EH Sbjct: 61 DLRTLLRFAKNRSTDLYWDYRAVPHFATWLARFWWESSAERLMAAARDMLPLIERSVTEH 120 Query: 121 DALIAAAGLEGLVQAKGWIEVFRDPA-LFEQAKTDAKGLSRYGLRFEILECGQLQAREHQ 179 + LI A L+ LV+A GWI+ +R PA L +A YGLR +L+ G L ARE Sbjct: 121 ERLIKRAELQHLVRATGWIDAYRTPARLAREAAAAEATAGSYGLRVSVLDGGTLAAREPG 180 Query: 180 LDATVVGGIHWLDPKTVNNPGALTRGYAALFLQRGGQFVHGDARSLRQANGQWRVESRRG 239 G +HW DP +V NPG LT+GYA LF GG + GDA +L G W V++ G Sbjct: 181 AVGGFCGALHWQDPMSVVNPGELTKGYARLFEASGGVVLTGDAATLSGRAGAWTVQTTSG 240 Query: 240 PITADEVVACLGPQSADLFSGLGYQIPLAIKRGYHMHY-STRDGAQLEHSICDTQGGYVL 298 I+A E V LGP S +F+ LGY+IPL +KRGYHMHY TR L D + GYV+ Sbjct: 241 RISAKEAVVALGPWSDCVFAPLGYRIPLRVKRGYHMHYRPTR--PMLSMPFVDAEQGYVV 298 Query: 299 APMARGVRLTTGIEFDAASAPGNQIQLGRCEALARKLFPALGDRLDDTPWLGRRPCLPDM 358 APM +RLTTG+E A IQLGR E AR F LG+RLDD+PWLG RPC PDM Sbjct: 299 APMEGRLRLTTGVEIARRDAEPTGIQLGRAERFARPSF-GLGERLDDSPWLGLRPCTPDM 357 Query: 359 RPVIGPAPRHPGLWFNFGHAHHGLTLGPVCGRLLAELLTGEPPFTDPAPYSATRF 413 RPVIG APRH GLWF FGH HHGLTLGP GRLLAE++TG P F DP P+ RF Sbjct: 358 RPVIGRAPRHTGLWFAFGHNHHGLTLGPATGRLLAEMMTGAPTFADPHPFRVERF 412 Lambda K H 0.322 0.140 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 414 Length adjustment: 31 Effective length of query: 383 Effective length of database: 383 Effective search space: 146689 Effective search space used: 146689 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory