Align Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase; Pyr2C/Pip2C reductase; N-methyl-L-amino acid dehydrogenase; EC 1.5.1.21; EC 1.4.1.17 (characterized)
to candidate H281DRAFT_02928 H281DRAFT_02928 uncharacterized oxidoreductase
Query= SwissProt::Q4U331 (343 letters) >FitnessBrowser__Burk376:H281DRAFT_02928 Length = 367 Score = 147 bits (372), Expect = 3e-40 Identities = 104/338 (30%), Positives = 160/338 (47%), Gaps = 15/338 (4%) Query: 6 ADQPTQTVSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSS 65 A T ++ QL +R I+ G++P A+++A++ +A G SHG+ IP Y++S Sbjct: 7 AGSTTPRIAADQLHAFVRAIWEQAGSAPREAELVADHLVAANLTGHDSHGVGMIPRYVAS 66 Query: 66 LASGWVD-GKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGS 124 LA G + VV+D GA + V+ GF Q A I +A+ G+ + +R + Sbjct: 67 LADGQLQLNLHADVVKDAGAV-LTVEGRKGFGQVVAFEAMEEGIARAQRIGICAVGLRDA 125 Query: 125 HHFAALWPDVEPFAEQGLVALSMVN--SMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIV 182 HH + E A GLV+ VN V P G GTNP PR G P+V Sbjct: 126 HHIGRIGHWAEQCARAGLVSFHFVNVAGDPLVAPFGGADRRIGTNPFCAAYPRPGKPPLV 185 Query: 183 FDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDG--GALLPFGGHKGSA 240 D ATS +A+G ++A +G+ +P G +D +G+PT +P+ + + G+L PFGGHKG Sbjct: 186 LDFATSTVAYGKTRVAYNQGKQVPPGALIDHEGVPTADPKVMHEEPFGSLTPFGGHKGFG 245 Query: 241 LSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGAGQHFAQRSEELVR 300 L+ M E+ + L GG F+ D A L ++IDP ++ + Sbjct: 246 LAAMCEIFSGALAGG-FTTHADTLGTTNAII--NCMLSVIIDPAAFDAPDAQAEADAFIA 302 Query: 301 QLH------GVGQERLPGDRRYLERARSMAHGIVIAQA 332 + GV PG+ + RA A GI + A Sbjct: 303 WVKASPLAAGVDHIYEPGEPERVTRAEREAQGIPVDAA 340 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 367 Length adjustment: 29 Effective length of query: 314 Effective length of database: 338 Effective search space: 106132 Effective search space used: 106132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory