Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate H281DRAFT_03367 H281DRAFT_03367 electron transfer flavoprotein alpha subunit apoprotein
Query= BRENDA::Q18AQ5 (336 letters) >FitnessBrowser__Burk376:H281DRAFT_03367 Length = 314 Score = 155 bits (391), Expect = 2e-42 Identities = 110/318 (34%), Positives = 164/318 (51%), Gaps = 17/318 (5%) Query: 5 LVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHY-GADEVIV 63 LV+ E I+ +L + A ++ D + L+ G + D A G +V++ Sbjct: 7 LVIAEHDNTSIKGATLNTIAAAQKVGGD----IHVLVAGQNAQAAADAAAKIAGVSKVLL 62 Query: 64 VDDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADCTGL 123 D LA E K D + AT+ G+++APR++A++ +D T + Sbjct: 63 ADAPQLAEGLAENVEATVLNIAK--DYSHIFAPATAYGKNIAPRIAAKLDVAQISDITAV 120 Query: 124 AVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEAVINRFKVE 183 + DT RP + GN +AT+ D ++ TVR + V K+E Sbjct: 121 D-SPDT----FERPIYAGNAIATVQSAD-PIKVITVRTTGFDAVAAEGGNATVE---KIE 171 Query: 184 FNDADKLVQVVQVIKEAKKQVKIEDAKILVSAGRGMGGKENLD-ILYELAEIIGGEVSGS 242 + Q V + ++ AKI+VS GRG+G EN +L LA+ + + S Sbjct: 172 AAADAGISQFVSREVTKLDRPELTSAKIIVSGGRGLGNGENYTKVLEPLADKLNAALGAS 231 Query: 243 RATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNPEAPIF 302 RA +DAG++ QVGQTGK V P LY+A GISGAIQH+AGM+D++ IVAINK+PEAPIF Sbjct: 232 RAAVDAGFVPNDYQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIF 291 Query: 303 KYADVGIVGDVHKVLPEL 320 AD G+VGD+ ++PEL Sbjct: 292 SVADYGLVGDLFTLVPEL 309 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 314 Length adjustment: 28 Effective length of query: 308 Effective length of database: 286 Effective search space: 88088 Effective search space used: 88088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory