Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate H281DRAFT_01346 H281DRAFT_01346 isovaleryl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >FitnessBrowser__Burk376:H281DRAFT_01346 Length = 393 Score = 221 bits (563), Expect = 3e-62 Identities = 142/380 (37%), Positives = 202/380 (53%), Gaps = 18/380 (4%) Query: 19 LTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGL 78 L EE M+RDS FA ++APR E R +Q ++R+ G++G+LG T+ E+YGG+ + Sbjct: 11 LGEEIEMLRDSIAGFAAKEIAPRAAEIDRTDQFPMDLWRKFGDLGVLGMTVSEEYGGANM 70 Query: 79 NYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFG 138 Y + + E+ R + S+L + I+ GTEAQKQKYLPKL SGE +G Sbjct: 71 GYTAHMVAMEEISRASASVGLSYGAHSNLCVNQIHRNGTEAQKQKYLPKLVSGEHVGALA 130 Query: 139 LTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDD----AGDIRGF 194 ++EPN GSD SM RA + Y L G+KMWITN P D VV+AK D + I F Sbjct: 131 MSEPNAGSDVVSMKLRADRKGDRYVLNGTKMWITNGPDCDTLVVYAKTDVEANSRGITAF 190 Query: 195 VLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVR-GLKGPFTCLNSARY 253 ++EKG +G S K+G+R S TGE+V +V VPEENI + G+K + L+ R Sbjct: 191 IVEKGMKGFSVAQKLDKLGMRGSHTGELVFQDVEVPEENILGQLNGGVKVLMSGLDYERA 250 Query: 254 GISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGR 313 ++ G G A Y DR+QFG+ + QLIQ K+AD+ T + +GR Sbjct: 251 VLAGGPTGIMVAVMDAVVPYIHDRKQFGQSIGEFQLIQGKVADLYTTLQACRAYLYAVGR 310 Query: 314 MKDE-GTAAVEITSIMKRNSCG--------KALDIARMARDMLGGNGISDEFGVARHLVN 364 D GTA V R C KA +A A +LGGNG +E+ V R + Sbjct: 311 QLDTLGTAHVR----QVRKDCAGVILYTAEKATWMAGEAIQILGGNGYINEYPVGRLWRD 366 Query: 365 LEVVNTYEGTHDVHALILGR 384 ++ GT ++ +++GR Sbjct: 367 AKLYEIGAGTSEIRRMLIGR 386 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 393 Length adjustment: 31 Effective length of query: 362 Effective length of database: 362 Effective search space: 131044 Effective search space used: 131044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory