GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lysN in Paraburkholderia bryophila 376MFSha3.1

Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate H281DRAFT_02907 H281DRAFT_02907 arginine:pyruvate transaminase

Query= SwissProt::P58350
         (410 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_02907 H281DRAFT_02907
           arginine:pyruvate transaminase
          Length = 395

 Score =  201 bits (511), Expect = 3e-56
 Identities = 128/383 (33%), Positives = 196/383 (51%), Gaps = 20/383 (5%)

Query: 25  EILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKYTALDGTPELK 84
           EI ++  +AAA    G  VI+L  G+PDF TP  + + A DA+  G+T Y+A+ G   L+
Sbjct: 19  EIHRVAQQAAA---NGNDVIVLSVGDPDFATPAPIVERAIDALRGGDTHYSAVSGRDPLR 75

Query: 85  KAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPYWTSYSDIVHI 144
            AI E+  R  G       + +  GA+  +F   +  L+ GDEVI+P P + +Y   V  
Sbjct: 76  AAIAEEQARMTGCTVSAANVILTAGAQNGVFATSLCLLEAGDEVIVPEPMYLTYEACVRA 135

Query: 145 CEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAADYRPLLEVLL 204
                V +  D +  F L  + LE A+TPRT+ +   +P NP+G     AD   +  +  
Sbjct: 136 AGATLVPVPVDPARAFHLDCDALERAVTPRTKAIFFATPCNPTGVVMPRADLERIARLAC 195

Query: 205 RHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMTGWRIGYAGGP 264
            H  +W+L D++Y  + ++  R        PG+  RT+T+  +SK++AM GWR+G+A GP
Sbjct: 196 EH-DLWVLSDEVYADLTFE--REHVSIMSLPGMAERTVTLGSLSKSHAMAGWRVGWAIGP 252

Query: 265 RELIKAMA-VVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDLVVNGLNAID 323
            +LI+ M  +  +     P  I QAA + AL      + +  + ++RRRD+V   L+ + 
Sbjct: 253 TQLIEHMGRLALAMLYGLPGFIQQAA-LTALQEKSSIVAQMRDIYRRRRDVVFERLSRVP 311

Query: 324 GLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVPGSAFG--LS 381
            L C +PE         AG+   V  SG  + T  DF   L     V+V+  SAFG   +
Sbjct: 312 RLRCLLPE---------AGMFMMVDVSGTGLDT-VDFTWQLFRAQGVSVLDASAFGETAN 361

Query: 382 PFFRISYATSEAELKEALERIAA 404
            F R+ +   EA L EA ERIAA
Sbjct: 362 GFVRLGFVVDEARLAEACERIAA 384


Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 389
Number of extensions: 25
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 410
Length of database: 395
Length adjustment: 31
Effective length of query: 379
Effective length of database: 364
Effective search space:   137956
Effective search space used:   137956
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory