Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate H281DRAFT_06478 H281DRAFT_06478 succinylornithine aminotransferase apoenzyme
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__Burk376:H281DRAFT_06478 Length = 411 Score = 189 bits (481), Expect = 1e-52 Identities = 127/378 (33%), Positives = 198/378 (52%), Gaps = 19/378 (5%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALT 137 DTQG+++ID GG + +GH +P ++ + Q +K + LA+ L LT Sbjct: 36 DTQGRDYIDFAGGIAVTALGHAHPELLKVLHEQGSKLWHIGNGYTNEPVLRLARRLEELT 95 Query: 138 PGKLKYSFFCNSGTESVEAALKLAKAYQSPR---GKFTFIATSGAFHGKSLGALSATAKS 194 +FF NSG E+ EAALKLA+ R K+ I+ + +FHG++ +S + Sbjct: 96 FADR--AFFANSGAEANEAALKLARRVAFERHGADKYEIISFTQSFHGRTFFTVSVGGQP 153 Query: 195 TFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYL 254 + + F P+ G H+P+ +I+A + A+ G AVI+EPIQGEGGVI P +L Sbjct: 154 KYSEGFGPVPQGIVHLPYNDIQAAQKAI------GAKTCAVIVEPIQGEGGVIPADPAFL 207 Query: 255 TAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIA 314 A+R+ CD+ GAL+I DEVQTG+GR+G +A + V PDIL AKALG G PIGA + Sbjct: 208 KALREACDQHGALLIFDEVQTGVGRSGYFYAYQDTGVTPDILTTAKALGNG-FPIGAMLT 266 Query: 315 TEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLA 374 T E+ + +H TT+GGNPL A A + ++ + L + ++L +L Sbjct: 267 TNELAAHF--KVGVHGTTYGGNPLGSAIAEKVVELISDPKLLEGVRTRSEVLKGHLAKLN 324 Query: 375 REYPDLVQEARGKGMLMAIEFVDNEIG--YNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432 + L E RGKG+L+ + D G +F + + V++ + +R P L Sbjct: 325 ERF-GLFDEVRGKGLLIGAQLTDAYKGRAKDFVTAAGQHGVIM--LMAGPDVLRFVPSLI 381 Query: 433 LTIEQCELVIKAARKALA 450 + ++ + KA+A Sbjct: 382 MPLDDMNEGFERLAKAIA 399 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 411 Length adjustment: 32 Effective length of query: 427 Effective length of database: 379 Effective search space: 161833 Effective search space used: 161833 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory