Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate H281DRAFT_03232 H281DRAFT_03232 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= uniprot:A8LLL4 (385 letters) >FitnessBrowser__Burk376:H281DRAFT_03232 Length = 283 Score = 118 bits (295), Expect = 2e-31 Identities = 72/228 (31%), Positives = 115/228 (50%), Gaps = 6/228 (2%) Query: 158 FANYENMLLDPNNSEGMARAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIAL 217 F NY L + M F+N++ +T+PA I I +AA A +ALA F G + L A Sbjct: 61 FDNYREAL----TTSPMLHYFWNSVLITVPAVIGSIALAAMAGFALAIYRFRGNSSLFAT 116 Query: 218 IVGLLVVPLQLALIPLLTLHNAIGIGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDII 277 V VP+Q+ +IP+ L +G+ L H F LRN++ LP +++ Sbjct: 117 FVAGNFVPVQVLMIPVRDLSLQLGVFNTVSALILFHVSFQTGFCALFLRNFIKQLPFELV 176 Query: 278 ENAKVDGATDFQIFTKIVLPLSFPALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMTN 337 E A+++GA ++ +F +IVLPL PALA+ AI F + WND A + +T Sbjct: 177 EAARIEGANEWTVFFRIVLPLIRPALAALAILVFTFVWNDYFWA--LCLTQGDDAAPITV 234 Query: 338 QIVELLGTRGGNWEILATAAFVSIAVPLLVFFSMQRFLVRGLLAGSVK 385 + L G W +++ + ++ + +FF+MQ+ V GL G+ K Sbjct: 235 GVAALKGQWTTAWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGATK 282 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 283 Length adjustment: 28 Effective length of query: 357 Effective length of database: 255 Effective search space: 91035 Effective search space used: 91035 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory