Align Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale)
to candidate H281DRAFT_01852 H281DRAFT_01852 Phosphocarrier protein HPr/phosphoenolpyruvate--protein phosphotransferase (EC 2.7.3.9)/PTS system IIA component, Glc family (TC 4.A.1)
Query= uniprot:P50829 (168 letters) >FitnessBrowser__Burk376:H281DRAFT_01852 Length = 851 Score = 126 bits (316), Expect = 1e-33 Identities = 66/155 (42%), Positives = 98/155 (63%), Gaps = 1/155 (0%) Query: 8 MGKIQEKVTEEVIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSPAEGEVIQ 67 M +Q + E++ +P G ++ L VPDPVF+QKM+G+GI+++P+S E++SP G+V Q Sbjct: 1 MKALQRPLRIELV-APLSGVMVPLETVPDPVFAQKMVGDGISIDPTSHELLSPLPGKVTQ 59 Query: 68 IFHTKHAVGIRTRSGIELLIHVGLETVNMNGEGFTAHIKEGDKVKVGDPLITCDLELIKE 127 + + HAV I SG+E+L+H+GL+TV + GEGFT +KEGD V G PLI D + Sbjct: 60 LHSSSHAVTITGASGLEVLLHIGLDTVLLRGEGFTPLVKEGDTVATGQPLIRFDPVYVGA 119 Query: 128 KASSTVIPIVIMNGEAVGSMVSAGEKAARKGESKL 162 KA+S + +VI NG+ V V A G+ L Sbjct: 120 KAASLLTQMVIANGDRVTRYVPAEGLVTAAGDVAL 154 Lambda K H 0.314 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 23 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 851 Length adjustment: 30 Effective length of query: 138 Effective length of database: 821 Effective search space: 113298 Effective search space used: 113298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory