Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate H281DRAFT_05890 H281DRAFT_05890 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= uniprot:C8WUQ9 (301 letters) >FitnessBrowser__Burk376:H281DRAFT_05890 Length = 317 Score = 97.4 bits (241), Expect = 4e-25 Identities = 63/205 (30%), Positives = 103/205 (50%), Gaps = 3/205 (1%) Query: 97 NSLVVGVVVAMAQSFITAMSAFAFSKLRFYGRKYGLMTLLLLQMFPNILAIAAFYTALAK 156 NSLV+G F+ ++A+AFS+ + L +L +M P I Y Sbjct: 114 NSLVIGFGSTFLAVFLGTLAAYAFSRFKVPLADDLLFFILSTRMMPPIAVAIPIYLMYRA 173 Query: 157 LNMIDM-LGSYILVMLGTSAFNIWLLKGYMDSVPKELDEAAVIDGATTWQRFIHVTLPLS 215 L + D +G +L + +WLLKG+MD +P+E +EAA++DG T Q F+ V LP + Sbjct: 174 LGLSDSYVGMIVLYTAVNVSLAVWLLKGFMDEIPREYEEAALVDGYTRLQAFVKVVLPQA 233 Query: 216 TPMMVVIFFLTLVGIFSEYMFAGTILQSPWNYTLGVGMYNLISGQFAKNWGEFAAAALLS 275 + L+ ++EY FA ++L S T+ I G+ ++W AAA L Sbjct: 234 ITGIAATAIFCLIFAWNEYAFA-SLLTSGDAQTM-PPFIPFIIGEGGQDWPAVAAATTLF 291 Query: 276 AVPLAIVFAVAQRYLTKGLVAGSVK 300 VP+ I V +++L +G+ G+V+ Sbjct: 292 VVPILIFTVVLRKHLLRGITFGAVR 316 Lambda K H 0.328 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 317 Length adjustment: 27 Effective length of query: 274 Effective length of database: 290 Effective search space: 79460 Effective search space used: 79460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory