Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate H281DRAFT_05701 H281DRAFT_05701 glycerol 3-phosphate ABC transporter ATP-binding protein
Query= reanno::psRCH2:GFF857 (371 letters) >FitnessBrowser__Burk376:H281DRAFT_05701 Length = 362 Score = 336 bits (861), Expect = 7e-97 Identities = 189/361 (52%), Positives = 244/361 (67%), Gaps = 16/361 (4%) Query: 1 MASVTLRDICKSYDGTPITRH-IDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGD 59 MA++TL+ + K+YDG H ID+D+ DGEFVV VGPSGCGKSTLLR++AGLE I+ G Sbjct: 1 MAALTLQGVKKTYDGKQFVLHGIDVDVNDGEFVVMVGPSGCGKSTLLRMVAGLERISEGT 60 Query: 60 LLIDNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAE 119 + I + VN+L PKDR++ MVFQ+YALYPHM+VAENM + LK+A VD+ +I +RV A A+ Sbjct: 61 ISIAGKVVNELEPKDRNIAMVFQNYALYPHMSVAENMGYALKIAGVDRAQIAQRVNAAAQ 120 Query: 120 ILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARL 179 IL+L+ LL+RKP++LSGGQRQRVA+GR +VREP VFLFDEPLSNLDA LRVQMR+EI RL Sbjct: 121 ILELEPLLQRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDARLRVQMRLEIQRL 180 Query: 180 HQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQM 239 H R+ +T +YVTHDQ+EAMTLA +++V+N G Q+G P +Y P FVAGF+GSP M Sbjct: 181 HARLATTSLYVTHDQIEAMTLAQRVIVMNKGHAEQIGAPTEVYERPATVFVAGFIGSPGM 240 Query: 240 NFVEVRAISASPETVTIELPSGYPLTLPVDGSA-----VSPGDPLTLGIRPEHFVMPDEA 294 N +E R S + T ++ P LP+ G A V+ G TLGIRPEH + P +A Sbjct: 241 NLLEGR---VSDDGSTFDVAGNGP-QLPLAGVASIGREVAKGREWTLGIRPEH-MSPGQA 295 Query: 295 DFTFHGQITV--AERLGQYNLLYLTLERLQDVITLCVDGNLRVTEGETFAAGLKADKCHL 352 D H +TV E LG NL + + +T + R GE L A H Sbjct: 296 DAP-HTTLTVDSCELLGADNLAHGRWGKHD--VTARLPHAHRPAAGEALQVALPARHLHF 352 Query: 353 F 353 F Sbjct: 353 F 353 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 362 Length adjustment: 30 Effective length of query: 341 Effective length of database: 332 Effective search space: 113212 Effective search space used: 113212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory