Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate H281DRAFT_03749 H281DRAFT_03749 carbohydrate ABC transporter ATP-binding protein, CUT1 family
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Burk376:H281DRAFT_03749 Length = 360 Score = 331 bits (849), Expect = 2e-95 Identities = 190/382 (49%), Positives = 246/382 (64%), Gaps = 29/382 (7%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M ++L I+KRY + + V +L I D EF+V VGPSGCGKST +RM+AGLE+I+ G Sbjct: 1 MAAVQLSGIFKRYGDTQ--VVHGIDLHIDDGEFVVLVGPSGCGKSTLMRMVAGLEEISGG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 +L I N+ +P+ R+I+MVFQ+YALYPH+SVYEN+AFG ++RK + R+ AA Sbjct: 59 DLMIGGTRANNLAPQQRNISMVFQSYALYPHLSVYENIAFGPRIRKESPANFKPRIEAAA 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 ++L L +L+R P LSGGQRQRVAMGRA+VR+ +FL DEPLSNLDAKLRV MR EI Sbjct: 119 KMLNLGGYLDRLPRALSGGQRQRVAMGRAVVREPSLFLFDEPLSNLDAKLRVQMRTEIKA 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +H+R+ T IYVTHDQ EAMT+ADRIV+M+A GRIEQIG P ELY+ PAN Sbjct: 179 LHQRLKNTVIYVTHDQIEAMTMADRIVVMNA----------GRIEQIGRPLELYDHPANL 228 Query: 241 FVAGFIGSPAMNFFEVTVEKERLVNQ---DGLSLALPQGQEKILE---EKGYLGKKVTLG 294 FVA F+GSP+MNF E LVN+ GL+L L G E +LE +G KVTLG Sbjct: 229 FVASFLGSPSMNFAEGV-----LVNRTQGSGLALKLADGGEIVLEGAPASATVGAKVTLG 283 Query: 295 IRPEDISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGE 354 +RPE I + + +T VT + V E G+E+ LY K G + R PGE Sbjct: 284 VRPEHI---ETITQT---PDVTMQVEVVEPTGAETHLYGKIGGDTWCVTTRQRSKVEPGE 337 Query: 355 KVQLTFNIAKGHFFDLETEKRI 376 +V L A H FD E+ +R+ Sbjct: 338 RVTLRLPAAHIHLFDTESGRRL 359 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 360 Length adjustment: 30 Effective length of query: 347 Effective length of database: 330 Effective search space: 114510 Effective search space used: 114510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory