Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate H281DRAFT_04148 H281DRAFT_04148 monosaccharide ABC transporter membrane protein, CUT2 family
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Burk376:H281DRAFT_04148 Length = 335 Score = 220 bits (560), Expect = 5e-62 Identities = 122/286 (42%), Positives = 180/286 (62%), Gaps = 8/286 (2%) Query: 57 TSNFASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVLAVSAVLG---MQVSLG 113 + +F S N N+LRQV+IN ++A GMT VILT GIDLSVGSV+A++ L M + Sbjct: 54 SDSFLSGANIENVLRQVSINAIIAVGMTCVILTGGIDLSVGSVMALAGTLAAGLMVAGMN 113 Query: 114 AAPGWAIPMFIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNND 173 A A+ + + GL G NG VA + +VTL TM RG A + G + + Sbjct: 114 ALAALAVGVAV--GLGFGAANGFFVAFAGMPPIIVTLATMGIARGLALIYTGGYPI--DG 169 Query: 174 IPSF-EWIGNGDFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRV 232 +P + + G+G L + + + + +++WV+L + G ++YAIGGN QA RL+G+RV Sbjct: 170 LPDWVSFFGSGKILGIQAPVVIMAVIYVIAWVLLERMPFGRYVYAIGGNEQATRLSGVRV 229 Query: 233 GLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIW 292 V L VY+I+GL S A + +RL N G G+ELDAIAAVV+GGTS+ GG GSI Sbjct: 230 ARVKLIVYTIAGLTSSFAAIVLTARLMSGQPNAGVGFELDAIAAVVMGGTSISGGRGSII 289 Query: 293 GTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAVILDKWRQK 338 GT++GAL++GV+NNGL ++G++ + Q V KG +I+LA+ + + R+K Sbjct: 290 GTLIGALLLGVLNNGLNMVGVNPYVQNVIKGGIILLAIYISRDRRK 335 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 335 Length adjustment: 28 Effective length of query: 316 Effective length of database: 307 Effective search space: 97012 Effective search space used: 97012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory