Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate H281DRAFT_04049 H281DRAFT_04049 glutathione transport system ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__Burk376:H281DRAFT_04049 Length = 640 Score = 264 bits (674), Expect = 5e-75 Identities = 135/279 (48%), Positives = 192/279 (68%), Gaps = 7/279 (2%) Query: 12 PLLQTVDLKKYFPQGKRI-------LKAVDGISIEIKEGETLGLVGESGCGKSTLGRTIL 64 P+L+ DL FP + + AV+ +S +++ GETL LVGESGCGKST GR++L Sbjct: 332 PILRVRDLVTRFPVRTGLFGRLTGRVHAVEKVSFDLRPGETLALVGESGCGKSTTGRSLL 391 Query: 65 KLLRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIH 124 +L+ G I F+GK+I++L ++ R+ +Q IFQDP SLNP++TVG I +PL++H Sbjct: 392 RLVESQSGSIEFDGKEISSLTGPALQALRRDIQFIFQDPFASLNPRLTVGFSIMEPLLVH 451 Query: 125 KIGTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPV 184 + E + RV LL+ VG+ E +PHEFSGGQ+QRI IARALALNPK ++ DE V Sbjct: 452 GVAQGAEAQARVAWLLEKVGLPPEAARRYPHEFSGGQRQRIAIARALALNPKVVIADESV 511 Query: 185 SALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKI 244 SALDVS+QAQI++L+ ++Q+++G++YLFI+H++AVVE +SH+VAVMYLG+IVE G + Sbjct: 512 SALDVSVQAQIVNLMLDLQRELGVAYLFISHDMAVVERVSHRVAVMYLGQIVEIGPRRAV 571 Query: 245 FLNPIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPI 283 F P HPYTR L+ +VP + + E+PSPI Sbjct: 572 FEAPQHPYTRKLMGAVPVADPARRHAKRMLAADEIPSPI 610 Score = 176 bits (445), Expect = 2e-48 Identities = 100/271 (36%), Positives = 155/271 (57%), Gaps = 13/271 (4%) Query: 6 GGIKMKPLLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILK 65 G + + +L +L F G+ AV +S+ ++ GETL +VGESG GKS +++ Sbjct: 13 GNLPTQRVLAVDNLSVAFRSGETTFNAVRNLSLMVERGETLAIVGESGSGKSVTSLALMR 72 Query: 66 LL-----RPDGGKIFFEGKD-----ITNLNDKEMKPYR-KKMQIIFQDPLGSLNPQMTVG 114 L+ R GG I F +D + + M+ R + +IFQ+P+ SLNP TVG Sbjct: 73 LIEHGGGRLAGGSIAFRRRDGSVLDLAKASSGTMRSIRGADIAMIFQEPMTSLNPVFTVG 132 Query: 115 RIIEDPLIIHKIGTKKERRKRVEELLDMVGI--GREFINSFPHEFSGGQQQRIGIARALA 172 I + + +H+ ++ LL++V I R FPH+ SGG +QR+ IA AL+ Sbjct: 133 DQISEAISLHQGKSRSAAFAETLRLLELVRIPEARRVAARFPHQLSGGMRQRVMIAMALS 192 Query: 173 LNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYL 232 P ++ DEP +ALDV+IQAQI+ L+ +Q +M + +FI H++ VV ++ +V VMY Sbjct: 193 CKPALLIADEPTTALDVTIQAQILQLIRGLQDEMNMGVIFITHDMGVVAEVADRVLVMYR 252 Query: 233 GKIVEYGDVDKIFLNPIHPYTRALLKSVPKI 263 G+ VE G D +F P HPYT+ALL +VP++ Sbjct: 253 GEKVEEGASDALFAAPSHPYTKALLAAVPRL 283 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 328 Length of database: 640 Length adjustment: 33 Effective length of query: 295 Effective length of database: 607 Effective search space: 179065 Effective search space used: 179065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory