Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate H281DRAFT_02632 H281DRAFT_02632 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= TCDB::Q72KX4 (268 letters) >FitnessBrowser__Burk376:H281DRAFT_02632 Length = 283 Score = 166 bits (420), Expect = 5e-46 Identities = 90/268 (33%), Positives = 159/268 (59%), Gaps = 5/268 (1%) Query: 6 LYGFLLLMAGF-FLLPVYLVVLTALKEPARITLETVWQWP-HPPYWESFRTAWEA--FRP 61 LY L +A F +LLP+ V++T+++ ++ W WP H +++ A Sbjct: 16 LYKASLPVALFVWLLPMLAVLITSIRSSDELSQGDYWAWPKHFALIDNYGAALTQTPMLH 75 Query: 62 KFQNSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSILIPLFQF 121 F NS+++ V + L + L+ S+ G+ LA + FRG+ ++ + G F+P Q ++IP+ Sbjct: 76 YFANSMLITVPSVLGAILLASMAGFALATYRFRGNIVVLFTFVAGNFVPVQILMIPVRDM 135 Query: 122 MKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFFGIFRHVIL 181 +GL+ +++ L++ HV + TL RN+ ++P EL+EAAR++GA + I+ ++L Sbjct: 136 ALKVGLFNTVWALIIFHVAFQTGFCTLFLRNFIKQLPFELIEAARVEGASEWTIYARIVL 195 Query: 182 PLSVPAFVVVAIWQFTQIWNEFLFAVTLTR-PESQPITVALAQLAGGEAVKWNLPMAGAI 240 PL PA + I FT +WN++ +A+ LT+ ++ PITV +A L G WNL AG++ Sbjct: 196 PLIRPALAALGILVFTFVWNDYFWALCLTQGDDAAPITVGVAALKGQWTTAWNLVAAGSV 255 Query: 241 LAALPTLLVYILLGRYFLRGLLAGSVKG 268 LAALP++L++ + ++F+ GL G+ KG Sbjct: 256 LAALPSVLMFFAMQKHFVAGLTFGASKG 283 Lambda K H 0.330 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 283 Length adjustment: 25 Effective length of query: 243 Effective length of database: 258 Effective search space: 62694 Effective search space used: 62694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory