Align fructokinase; EC 2.7.1.4 (characterized)
to candidate H281DRAFT_05211 H281DRAFT_05211 2-dehydro-3-deoxygluconokinase
Query= CharProtDB::CH_012664 (307 letters) >FitnessBrowser__Burk376:H281DRAFT_05211 Length = 329 Score = 119 bits (299), Expect = 7e-32 Identities = 98/286 (34%), Positives = 135/286 (47%), Gaps = 20/286 (6%) Query: 29 GAPANVAVGIARLGGTSGFIGRVGDDPFGALMQRTLLTEGVDITYLKQDEWHRTSTVLVD 88 GA NVA+G+ARLG G++ RVG+D FG ++ TL EG+D + DE + T L Sbjct: 40 GADLNVAIGLARLGFKVGWMSRVGNDSFGQYVRDTLTKEGIDQRCVSTDERYPTGFQLKS 99 Query: 89 LNDQG-ERSFTFMVRPSADLFLETTD------LPCWRHGEWLHLCSIALS-AEPSRTSAF 140 ND G + + + R SA L D LP RH LHL +A + + SR AF Sbjct: 100 KNDDGSDPAVEYFRRGSAASHLSVADYVADYVLPA-RH---LHLTGVAPAISASSRELAF 155 Query: 141 TAMTAIRHAGGFVSFDPNIREDLWQDEHLLRLCLRQALQLADVVKLSEEEWRLISGKTQN 200 +R AG +SFDPN+R LW + L LAD V E +++G T+ Sbjct: 156 HLAREMRAAGKTISFDPNLRPTLWPSRAAMVEGLNALAALADWVLPGIGEGEILTGYTKP 215 Query: 201 DRDICALAKEYEIAMLLVTKGAEGVVVCYRGQVHHFAGMSV-NCVDSTGAGDAFVAGLLT 259 D DI E ++V GAEG AG V VD+ GAGD F G+++ Sbjct: 216 D-DIAKFYLEQGARGVVVKLGAEGAYFRTADDAGVIAGQPVAKVVDTVGAGDGFAVGVIS 274 Query: 260 GLSSTGLSTDEREMRRIIDLAQRCGALAVTAKGAMTALPCRQELES 305 L + R + + + R GALA+ G LP R EL++ Sbjct: 275 AL------LEGRTLPQAVARGNRIGALAIQVIGDSEGLPVRAELDA 314 Lambda K H 0.321 0.136 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 329 Length adjustment: 27 Effective length of query: 280 Effective length of database: 302 Effective search space: 84560 Effective search space used: 84560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory