Align Inositol transport system sugar-binding protein (characterized)
to candidate H281DRAFT_04462 H281DRAFT_04462 monosaccharide ABC transporter substrate-binding protein, CUT2 family
Query= reanno::Phaeo:GFF715 (316 letters) >FitnessBrowser__Burk376:H281DRAFT_04462 Length = 348 Score = 323 bits (827), Expect = 5e-93 Identities = 161/323 (49%), Positives = 213/323 (65%), Gaps = 28/323 (8%) Query: 22 ATTASAEGEKYILVSHAPDSDSWWNTIKNGIALAGEQMNVEVEYRNPPTGDLADMARIIE 81 A+ A A ++L+SHAPDSDSWWNTIKN I A E NVE +YRNPP GD+ADMAR++E Sbjct: 26 ASAARAADAHFVLISHAPDSDSWWNTIKNAIKQADEDFNVETDYRNPPNGDIADMARLVE 85 Query: 82 QAAASGPNGIITTLSDYDVLSGPIKAAVDSGVDVIIMNSGTPDQAREVGALMYVGQPEYD 141 QAAA +G+I T++DYDVL I + ++ +NSGT +Q+ ++GA+M++GQPEY Sbjct: 86 QAAARNYDGVIVTIADYDVLKSSINKVTAKKIPLVTINSGTEEQSAQLGAIMHIGQPEYV 145 Query: 142 AGHAAGMRAKADGVGSFLCVNHYISSPSSTERCQGFADGLGVDLGDQMIDSGQDPAEIKN 201 AG AAG +AKA GV SFLCVNH ++ S +RC+GFA+ LGVD IDSGQDP EI++ Sbjct: 146 AGKAAGEKAKAAGVKSFLCVNHLATNTVSFDRCRGFAEALGVDYKSSTIDSGQDPTEIQS 205 Query: 202 RVLAYLNTNPETDAILTLGPTSADPTLLALDENGMAGDIYFGTFDLGEEIVKGLKSGVIN 261 +V AYL +P T AILTLGPT A TL A+ + G+ G IYF TFD ++I K +++G I Sbjct: 206 KVSAYLRNHPNTGAILTLGPTPASATLKAVQQMGLNGKIYFCTFDFSDDIAKAIQNGTIQ 265 Query: 262 WGIDQQPFLQAYLPVVVLTNYHR-------------------------YGVLPG---NNI 293 + IDQQP+LQ Y+PV VL + YG+ P NI Sbjct: 266 FAIDQQPYLQGYIPVAVLAIVKKEHTTDPAKIRQILEANPKFKARLATYGLAPSYGPKNI 325 Query: 294 NSGPGFVTKDGLEKVEEFAGEYR 316 SGPGF+TK+ L+KV ++AG+YR Sbjct: 326 RSGPGFITKENLDKVIKYAGQYR 348 Lambda K H 0.315 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 348 Length adjustment: 28 Effective length of query: 288 Effective length of database: 320 Effective search space: 92160 Effective search space used: 92160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory