Align Inositol transport system permease protein (characterized)
to candidate H281DRAFT_01120 H281DRAFT_01120 monosaccharide ABC transporter membrane protein, CUT2 family
Query= reanno::Phaeo:GFF716 (373 letters) >FitnessBrowser__Burk376:H281DRAFT_01120 Length = 333 Score = 144 bits (363), Expect = 3e-39 Identities = 102/325 (31%), Positives = 155/325 (47%), Gaps = 37/325 (11%) Query: 36 ITVFAMFLIFAGDSGMFNS-QGVMNWSQISAQFMIIAVGACLLMIAGEFDLSVGSMIGFA 94 I + ++F+ S F S +N + +A IIA+G ++IA + DLSVGS + + Sbjct: 40 IAFAVLLVVFSFASPWFLSIDNFLNIGRQTALVSIIAIGMTFVIIARQIDLSVGSSLALS 99 Query: 95 GMLIAIFSVTLGWPVWLAILVTFAIATAIGALNGFIVVRTGLPSFIVTLAFLFILRGFAI 154 GM A+ +G + + +G +NG + R +PSF+VTL L RG A+ Sbjct: 100 GMSAALAMAYIGDHWLIGAVAGIGTGALVGVINGLVTTRLNIPSFLVTLGSLSAARGLAL 159 Query: 155 YLPQTIERKTIIGGVADAAEGDWLAALFGGKILTGLFQWFGDNGWIAVFERGTRKGQPVV 214 + T K +I ++ +IA+F G+ + Sbjct: 160 LVTTT---KPVI---------------------------ITNDSFIAIF------GEGDI 183 Query: 215 EGLPMLIVWAILLVIIGHVILTKTRFGNWIFAAGGDAEAARNSGVPVNRVKILMFMFTAF 274 G+P+ I+W +L VI G ++L + FG ++AAGG+ AAR SG+ + RV L F+ T Sbjct: 184 AGVPVPIIWTVLAVIAGILLLHYSVFGRQVYAAGGNPTAARYSGIDIRRVTTLAFILTGV 243 Query: 275 CATVFATCQVMEFGGAGSDRGLLKEFEAIIAVVIGGALLTGGYGSVLGAALGALIFGVVQ 334 A + A A D E + I +V +GG L GG G VLG LG+LI G + Sbjct: 244 LAGLAALVLSARSHAARPDVVQGLELDVIASVTLGGCSLFGGRGFVLGTLLGSLIIGTLN 303 Query: 335 QGLFFAGVESSLFRVFLGLILLFAV 359 GL GV SSL V G+I++ AV Sbjct: 304 NGLVLLGVSSSLQLVIKGIIIVAAV 328 Lambda K H 0.330 0.145 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 333 Length adjustment: 29 Effective length of query: 344 Effective length of database: 304 Effective search space: 104576 Effective search space used: 104576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory