Align Rhizopine-binding protein (characterized, see rationale)
to candidate H281DRAFT_02173 H281DRAFT_02173 monosaccharide ABC transporter substrate-binding protein, CUT2 family
Query= uniprot:A0A0N9WNI6 (308 letters) >FitnessBrowser__Burk376:H281DRAFT_02173 Length = 343 Score = 130 bits (328), Expect = 3e-35 Identities = 89/286 (31%), Positives = 143/286 (50%), Gaps = 7/286 (2%) Query: 25 LRIGVSMSQFDDTWLTYLRESMDKQAKSMPDGVKLQFEDARSDVVKQLSQVESFISQKVD 84 L++G + ++ ++ W L E+ + + G +L DA KQ+S ++S I+Q VD Sbjct: 55 LKVGFAQTESNNPWR--LAETRSFKEVAAKCGWQLVMTDANGSNSKQVSDIQSMIAQHVD 112 Query: 85 AIVVNPVDTAATRKITEAAVKAGIPLVYVNRRPDDLKLPKG---VITVASNDLEAGQMQM 141 +V P + + A KAGIP++ V+R D G + + S+ ++ G Sbjct: 113 LLVFPPREEKPLAPVVLQAKKAGIPVILVDRNVDQSVAVAGRDYITFIGSDFIDQGHRAA 172 Query: 142 QYLAEKMKGKGDIVILLGDLANNSTTNRTKGVKEVLAKYPGIKIDQEQTGTWSRDKGMTL 201 +L + GK I+ L G ++ +R KG E++AK PG+ I Q+G ++RDKG + Sbjct: 173 DWLVKATGGKAKIIELEGTTGASAANDRKKGFDEIIAKNPGMTIIASQSGDFARDKGRQV 232 Query: 202 VNDWLTQGRKFDAIVSNNDEMAIGAAMALKQAGVEKG-SVLIAGVDGTPDGLRAVKKGDL 260 + L A+ ++NDEMA+GA A+K AG + G + I +DGT GL A+ G+L Sbjct: 233 METLLQAHPDVTAVYAHNDEMALGAIAAIKAAGKQPGKDIQIVTIDGTKGGLDAIAAGEL 292 Query: 261 AVSVFQDANGQAVDSIDAAVKMAKNEPVEQAVWVPYRLITPENVDQ 306 SV Q + + D A + AK E + V V R NV Q Sbjct: 293 GASV-QSSPFFGPLACDVAQRYAKGEKIPTWVKVSDRFYDKSNVQQ 337 Lambda K H 0.315 0.130 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 343 Length adjustment: 28 Effective length of query: 280 Effective length of database: 315 Effective search space: 88200 Effective search space used: 88200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory