Align Rhizopine-binding protein (characterized, see rationale)
to candidate H281DRAFT_05225 H281DRAFT_05225 monosaccharide ABC transporter substrate-binding protein, CUT2 family
Query= uniprot:A0A0N9WNI6 (308 letters) >FitnessBrowser__Burk376:H281DRAFT_05225 Length = 320 Score = 106 bits (265), Expect = 6e-28 Identities = 79/242 (32%), Positives = 119/242 (49%), Gaps = 9/242 (3%) Query: 66 SDVVKQLSQVESFISQKVDAIVVNPVDTAATRKITEAAVKAGIPLVYVNRR--PDDLKLP 123 +D Q+ VE I KVDAIV+ P D+ A + + AV AGI +V ++ R PD LK Sbjct: 80 TDTANQIRIVEQMIVSKVDAIVLAPADSKALVPVVKKAVDAGIIVVNIDNRLDPDVLKSK 139 Query: 124 K-GVITVASNDLEAGQMQMQYLAEKMKGKGDIVILLGDLANNSTTNRTKGVKEVLAKYPG 182 V V ++ + Q YLA+K+K ++ I+ G + RT G K+ + G Sbjct: 140 DLNVPFVGPDNRKGAQKVGDYLAKKLKAGDEVGIIEGVSTTTNAQQRTAGFKDAMQTV-G 198 Query: 183 IKIDQEQTGTWSRDKGMTLVNDWLTQGRKFDAIVSNNDEMAIGAAMALKQAGVEKGSVLI 242 K+ Q+G W DKG + + L + A+++ ND MAIGA A++ AG ++G V++ Sbjct: 199 AKVVSVQSGEWEIDKGNAVASAMLNEYPNLKALLAGNDNMAIGAVSAVRAAG-KQGKVMV 257 Query: 243 AGVDGTPDGLRAVKKGDLAVSVFQDANGQAVDSIDAAVKM----AKNEPVEQAVWVPYRL 298 G D +K G + + Q A QAV ID A+K K + V P L Sbjct: 258 VGYDNINAIKPMLKDGRVLATADQYAAKQAVFGIDTALKALSEHKKQSQLSGVVETPCDL 317 Query: 299 IT 300 +T Sbjct: 318 VT 319 Lambda K H 0.315 0.130 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 320 Length adjustment: 27 Effective length of query: 281 Effective length of database: 293 Effective search space: 82333 Effective search space used: 82333 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory