Align scyllo-inosose 3-dehydrogenase; 2-keto-myo-inositol dehydrogenase; EC 1.1.1.- (characterized)
to candidate H281DRAFT_01693 H281DRAFT_01693 Threonine dehydrogenase
Query= SwissProt::Q9WYP3 (395 letters) >FitnessBrowser__Burk376:H281DRAFT_01693 Length = 381 Score = 118 bits (296), Expect = 2e-31 Identities = 90/271 (33%), Positives = 131/271 (48%), Gaps = 36/271 (13%) Query: 34 VWRYP-EVRVEEVPEPRIEKPTEIIIKVKACGICGSDVHMAQTDEEGYILYPGLTGFPV- 91 V+R P +V VE VP+P+IE+PT++I+++++ ICGSD+HM + G T F Sbjct: 5 VYRGPRDVSVENVPDPKIERPTDVIVQIRSTNICGSDLHM----------FEGRTDFEKG 54 Query: 92 -TLGHEFSGVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPNHCENLN- 149 GHE G V E G + +R ++G+ VC + CGHCR C +G C N Sbjct: 55 RVFGHENLGQVTEVG------QAVERLKVGDWVCMPFNISCGHCRNCEKGLTAFCLAANP 108 Query: 150 -------ELGF----NVDGAFAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVA 198 GF G AEY++V L+ E ++ + + PT Sbjct: 109 EPGMAGAAFGFADMGPYQGGQAEYLRVPWADFNCLKLPPDAEEKQNDYVMVADIFPTGWH 168 Query: 199 YNAVIVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGAD 258 + G+RPGD VVI G GP+GL A GA V++ + R LA+ +GA Sbjct: 169 CTEL----AGMRPGDAVVIYGSGPVGLMAAHAAMVKGACNVMVVDRHPDRLRLAESIGA- 223 Query: 259 HVIDPTKENFVEAVLDYTNGLGAKLFLEATG 289 ID +K N VE + + T+GLGA + E G Sbjct: 224 VAIDDSKCNPVERIKELTHGLGADVGCECVG 254 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 381 Length adjustment: 30 Effective length of query: 365 Effective length of database: 351 Effective search space: 128115 Effective search space used: 128115 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory