Align scyllo-inosose 3-dehydrogenase; 2-keto-myo-inositol dehydrogenase; EC 1.1.1.- (characterized)
to candidate H281DRAFT_03278 H281DRAFT_03278 Threonine dehydrogenase
Query= SwissProt::Q9WYP3 (395 letters) >FitnessBrowser__Burk376:H281DRAFT_03278 Length = 402 Score = 119 bits (298), Expect = 2e-31 Identities = 82/266 (30%), Positives = 131/266 (49%), Gaps = 34/266 (12%) Query: 39 EVRVEEVPEPRIEKPTEIIIKVKACGICGSDVHMAQTDEEGYILYPGLTGFPVTLGHEFS 98 ++R++ VP+P++E+PT+ ++++ + ICG+D+HM + G + PG LGHE Sbjct: 11 DIRLDNVPDPKLEQPTDALVRLTSSAICGTDLHMVRGTLGGMV--PG-----TILGHEGI 63 Query: 99 GVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPNHCENLNELGFNVDGA 158 G+V E G N R G+ V + CG C C G+ C+N N G + A Sbjct: 64 GIVEEVGRSVRNLRQ------GDRVLIPSTISCGFCSYCRSGYTAQCDNANPNGASAGTA 117 Query: 159 F--------------AEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIV 204 F A+Y + +A SL L + DR L + PT + A + Sbjct: 118 FFGGPKTTGPFQGLQAQYARTPLAHA-SLIRLPDEIDDDRAILLSDIF-PTGY-FGAQL- 173 Query: 205 RGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVIDPT 264 G+R GD V + G GP+G A+A K GA +VI + R ++A+ GA+ VI+ Sbjct: 174 --AGVRTGDTVAVFGAGPVGQFAIASAKLMGAGRVIAVDRIASRLDMARTQGAE-VINFD 230 Query: 265 KENFVEAVLDYTNGLGAKLFLEATGV 290 +E+ V+ +L T G+G ++A GV Sbjct: 231 EEDPVDMILQLTGGIGVDRVIDAVGV 256 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 402 Length adjustment: 31 Effective length of query: 364 Effective length of database: 371 Effective search space: 135044 Effective search space used: 135044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory