Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate H281DRAFT_04459 H281DRAFT_04459 5-dehydro-2-deoxygluconokinase
Query= SwissProt::Q53W83 (309 letters) >FitnessBrowser__Burk376:H281DRAFT_04459 Length = 682 Score = 123 bits (309), Expect = 1e-32 Identities = 100/332 (30%), Positives = 153/332 (46%), Gaps = 39/332 (11%) Query: 3 EVVTAGEPLVALVPQEPG-HLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDEL 61 ++V G V L Q+ G L Y+GG+ N+A ARLG+ + RVG D + Sbjct: 30 DIVCLGRLAVDLYAQQVGARLEDVSSFAKYLGGSSANIAFGCARLGLASAMLARVGNDHM 89 Query: 62 GAMVEERLRAEGVDLTHFRRAPG------FTGLYLREYLPLGQGRVFYYRKGSAGSALAP 115 G + E L EG D++H R P GL R+ PL +YR+ A A+ Sbjct: 90 GRFLTETLTKEGCDVSHVRVDPERLTALVLLGLKDRDTFPL-----IFYRENCADMAVDE 144 Query: 116 GAFDPDYLEGVRFLHLSGITPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLW---- 171 FD ++ + L ++G T + + S A++ A+R VR LD++YR LW Sbjct: 145 ADFDEAFIASSKALLITG-THFSTEQVNRTSRRALDYARRNQVRTVLDIDYRPVLWGLTG 203 Query: 172 ---------SPEEARGFLERALPGVDLLFLSEEEAELLFGRVE-----EALRALSAPEVV 217 + E L+R LP DL+ +EEE + G+ + +RA++ +V Sbjct: 204 KADGETRFVASEGVTAHLQRILPLFDLVIGTEEEFRIAGGKSDLLDALAMVRAVTPATLV 263 Query: 218 LKRGAKGAW-------AFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLPVEER 270 LKRG G A +D V G VE ++ +GAGDAFA+G+L+G + P++ Sbjct: 264 LKRGPMGCQIIDGEVPASLDDTPVHGGV-EVEVLNVLGAGDAFASGFLSGWLRDQPLDAC 322 Query: 271 LRLANLLGASVAASRGDHEGAPYREDLEVLLK 302 R AN GA V + P +L+ L+ Sbjct: 323 ARAANASGALVVSRHACAPAMPTPAELDYFLR 354 Lambda K H 0.320 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 682 Length adjustment: 33 Effective length of query: 276 Effective length of database: 649 Effective search space: 179124 Effective search space used: 179124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory