Align D-mannonate oxidoreductase (EC 1.1.1.57) (characterized)
to candidate H281DRAFT_02952 H281DRAFT_02952 fructuronate reductase
Query= ecocyc::MANNONOXIDOREDUCT-MONOMER (486 letters) >FitnessBrowser__Burk376:H281DRAFT_02952 Length = 497 Score = 370 bits (950), Expect = e-107 Identities = 209/467 (44%), Positives = 268/467 (57%), Gaps = 14/467 (2%) Query: 10 PVAR----PSWDHSRLESRIVHLGCGAFHRAHQALYTHHLLESTDSDWGICEVNLMPGND 65 P AR P++D + L IVHLG GAFHRAHQA+YT H L + D WGI V+L + Sbjct: 14 PAARGIVVPTYDRASLAPGIVHLGLGAFHRAHQAVYTEHTLRAGDHRWGIVGVSLRRADT 73 Query: 66 RVLIENLKKQQLLYTVAEKGAESTELKIIGSMKEALHPEIDGCEGILNAMARPQTAIVSL 125 E L Q LYTV + + +++G++ +L +L+AM P+ IVSL Sbjct: 74 S---EALTAQDHLYTVDVRDGAADSFQVVGALIASLVAP-QSPAAVLDAMTDPRGHIVSL 129 Query: 126 TVTEKGYCADAASGQLDLNNPLIKHDLENPTAPKSAIGYIVEALRLRREKGLKAFTVMSC 185 T+TEKGYC + ASG L+ ++P I HDL +AP+SAIG++V AL LRR GL+ TVMSC Sbjct: 130 TITEKGYCRNPASGALEFDHPDIDHDLREGSAPRSAIGFVVRALALRRAAGLRPLTVMSC 189 Query: 186 DNVRENGHVAKVAVLGLAQARDPQLAAWIEENVTFPCTMVDRIVPAATPETLQEIADQLG 245 DN+ NG + L A+ DP LA WIE FP TMVDRIVP T +A++LG Sbjct: 190 DNLPSNGDTMRALTLAFAREADPALADWIEREGAFPNTMVDRIVPLTTDADRTRVAEELG 249 Query: 246 VYDPCAIACEPFRQWVIEDNFVNGRPDWDKVGAQFVADVVPFEMMKLRMLNGSHSFLAYL 305 YD + EPF QWVIED F RP W++ GA V D P+E KLRMLNG+HS LAYL Sbjct: 250 AYDAWPVITEPFSQWVIEDRFAGPRPAWERAGATLVRDARPYEQAKLRMLNGAHSALAYL 309 Query: 306 GYLGGYETIADTVTNPAYRKAAFALMMQEQAPTLSMPEGTDLNAYATLLIERFSNPSLRH 365 G L GY+T+ + PA +++ E PTLS P L Y L RF N +L H Sbjct: 310 GSLIGYDTVDQAIGAPALLNFVESMLRDEVEPTLSRPA---LARYRADLFTRFRNTALDH 366 Query: 366 RTWQIAMDGSQKLPQRLLDPVRLHLQNGGSWRHLALGVAGWMRYTQGVDEQGNAIDVVDP 425 R QIA DGSQKLPQR L+ VR +L++G LA +AGW+ Y G DE G + DP Sbjct: 367 RLQQIATDGSQKLPQRWLESVRANLKSGAPTECLAFALAGWIAYLGGQDETGRTYVIADP 426 Query: 426 M---LAEFQKINAQYQGADRVKALLGLSGIFADDLPQNADFVGAVTA 469 + LAE ++ D V+AL + IF DL + FV V A Sbjct: 427 LAGTLAEAVRLTLHADAIDAVQALFEIESIFGCDLRAHPRFVAQVAA 473 Lambda K H 0.320 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 683 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 497 Length adjustment: 34 Effective length of query: 452 Effective length of database: 463 Effective search space: 209276 Effective search space used: 209276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory