Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate H281DRAFT_02091 H281DRAFT_02091 hypothetical protein
Query= SwissProt::Q2LQN9 (414 letters) >FitnessBrowser__Burk376:H281DRAFT_02091 Length = 378 Score = 248 bits (632), Expect = 3e-70 Identities = 140/379 (36%), Positives = 214/379 (56%), Gaps = 9/379 (2%) Query: 37 LTEEQKLLMEMVRNLAVREIAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGGTGM 96 L ++ ++ + +R + P A D +FP A+LG LVP YGG GM Sbjct: 3 LDQDHLMVRDALRTFVREAVTPYAATWDRERTFPKDVHRQLAELGAYGVLVPETYGGAGM 62 Query: 97 DITTFAMVLEEIGKVCASTALMLLAQADGMLSIILD-GSPALKEKYLPRFGEKSTLMTAF 155 D A++LEEI T+ + + SI+L G+ A K ++L + ++ AF Sbjct: 63 DALALALILEEIAAGDGGTSTAISVNNCPVCSILLTYGNDAQKREWLTPLA-RGEMLGAF 121 Query: 156 AATEPGAGSDLLAMKTRAV--KKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAKGM 213 TEP AGSD A++T A K GD YV+NG K FIT+G D+ V A TD + G +G+ Sbjct: 122 CLTEPQAGSDASALRTTATRDKDGDAYVLNGVKQFITSGKNGDVAIVMAVTDKAAGKRGI 181 Query: 214 STFVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGALSI 273 S F+V + G + E K+G +++ FED VPA NL+G EG+G+ + L Sbjct: 182 SAFIVPTDSKGYVVARVEDKLGQHSSDTAQIIFEDCRVPAANLIGAEGEGYRIALSGLEG 241 Query: 274 NRVFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLLVRK 333 R+ A+Q+VG+A+ A E A+ + +ERE FG+P+ +QF +ADMAT++EAAR L+ Sbjct: 242 GRIGIAAQSVGMARAAYEAALTYAKERESFGQPLFSHQAVQFRLADMATQLEAARQLIWH 301 Query: 334 ATTLLDAKDKRGPLI--GGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMREAKL 391 A +L KD P + MAK FAS+ A ++ + A+Q+ GG GY+ ++ VER+ R+ ++ Sbjct: 302 AASL---KDAGQPCLTEAAMAKLFASEAAERICSAALQIHGGYGYLSDFPVERIYRDVRV 358 Query: 392 TQIYTGTNQITRMVTGRSL 410 QIY GT+ I +++ R L Sbjct: 359 CQIYEGTSDIQKILIARGL 377 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 378 Length adjustment: 31 Effective length of query: 383 Effective length of database: 347 Effective search space: 132901 Effective search space used: 132901 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory